BLASTX nr result
ID: Mentha29_contig00020193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020193 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28656.1| hypothetical protein MIMGU_mgv1a0052221mg [Mimulu... 63 5e-08 ref|XP_006357278.1| PREDICTED: micronuclear linker histone polyp... 56 5e-06 ref|XP_004238731.1| PREDICTED: uncharacterized protein LOC101245... 56 5e-06 ref|XP_002520203.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >gb|EYU28656.1| hypothetical protein MIMGU_mgv1a0052221mg [Mimulus guttatus] Length = 493 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 100 MDDSAKSGAGLEVSVSFGRFENDALSWEKWSSF 2 MDDS KS + LEVSVSFGRFENDALSWEKWSSF Sbjct: 1 MDDSVKSDSRLEVSVSFGRFENDALSWEKWSSF 33 >ref|XP_006357278.1| PREDICTED: micronuclear linker histone polyprotein-like [Solanum tuberosum] Length = 587 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -2 Query: 100 MDDSAKSGAGLEVSVSFGRFENDALSWEKWSSF 2 M DS S LEVSVSFGRFENDALSWEKWSSF Sbjct: 15 MGDSVVSHPTLEVSVSFGRFENDALSWEKWSSF 47 >ref|XP_004238731.1| PREDICTED: uncharacterized protein LOC101245760 [Solanum lycopersicum] Length = 602 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -2 Query: 100 MDDSAKSGAGLEVSVSFGRFENDALSWEKWSSF 2 M DS S LEVSVSFGRFENDALSWEKWSSF Sbjct: 15 MGDSVVSRPTLEVSVSFGRFENDALSWEKWSSF 47 >ref|XP_002520203.1| conserved hypothetical protein [Ricinus communis] gi|223540695|gb|EEF42258.1| conserved hypothetical protein [Ricinus communis] Length = 556 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 100 MDDSAKSGAGLEVSVSFGRFENDALSWEKWSSF 2 M ++A S LEVSVSFGRFEND+LSWEKWSSF Sbjct: 15 MGETATSDRSLEVSVSFGRFENDSLSWEKWSSF 47