BLASTX nr result
ID: Mentha29_contig00019794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00019794 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004508680.1| PREDICTED: histone deacetylase 5-like [Cicer... 60 2e-07 >ref|XP_004508680.1| PREDICTED: histone deacetylase 5-like [Cicer arietinum] Length = 661 Score = 60.5 bits (145), Expect = 2e-07 Identities = 36/76 (47%), Positives = 46/76 (60%), Gaps = 11/76 (14%) Frame = -3 Query: 203 VIQEVRRELSSYWPVLSVELTEKIISKTA---QIEIPSSDSEAETEG--------ITLIE 57 VIQ VR+ELS +WP L+ EL + II + A SSDSE E E L+E Sbjct: 360 VIQAVRQELSPFWPTLACELPQSIIGQVAPPPHTLFSSSDSETEDEKAPLKFKNIAELLE 419 Query: 56 DVIQPFSNLEVDSDGQ 9 DVI+PFS L+VD+DG+ Sbjct: 420 DVIKPFSTLKVDADGE 435