BLASTX nr result
ID: Mentha29_contig00019329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00019329 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492282.1| PREDICTED: sodium/hydrogen exchanger 7-like ... 57 3e-06 ref|XP_006448057.1| hypothetical protein CICLE_v10018329mg [Citr... 57 3e-06 >ref|XP_006492282.1| PREDICTED: sodium/hydrogen exchanger 7-like isoform X1 [Citrus sinensis] Length = 1148 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/53 (62%), Positives = 36/53 (67%), Gaps = 7/53 (13%) Frame = +1 Query: 232 MASILEIGTASLPLRVLEEESASGG-------NPTDAVLFVGISLVLGIASRH 369 M S+ E G LP R+LEEE SGG NPTDAV+FVGISLVLGIA RH Sbjct: 1 MESVSE-GLLQLPYRILEEEQKSGGGSSPSEGNPTDAVIFVGISLVLGIACRH 52 >ref|XP_006448057.1| hypothetical protein CICLE_v10018329mg [Citrus clementina] gi|557550668|gb|ESR61297.1| hypothetical protein CICLE_v10018329mg [Citrus clementina] Length = 330 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/53 (62%), Positives = 36/53 (67%), Gaps = 7/53 (13%) Frame = +1 Query: 232 MASILEIGTASLPLRVLEEESASGG-------NPTDAVLFVGISLVLGIASRH 369 M S+ E G LP R+LEEE SGG NPTDAV+FVGISLVLGIA RH Sbjct: 1 MESVSE-GLLQLPYRILEEEQKSGGGSSPSEGNPTDAVIFVGISLVLGIACRH 52