BLASTX nr result
ID: Mentha29_contig00018497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018497 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520768.1| phenazine biosynthesis protein, putative [Ri... 56 5e-06 >ref|XP_002520768.1| phenazine biosynthesis protein, putative [Ricinus communis] gi|223540153|gb|EEF41730.1| phenazine biosynthesis protein, putative [Ricinus communis] Length = 489 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 ASERSGVLIIHLEEKNQRVLLRGEAVAVMEGSLLV 105 AS RSG+L IHL+E+NQRVLLRG+AV VMEGSLLV Sbjct: 455 ASPRSGILDIHLDEQNQRVLLRGKAVTVMEGSLLV 489