BLASTX nr result
ID: Mentha29_contig00018004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018004 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43518.1| hypothetical protein MIMGU_mgv1a004063mg [Mimulus... 64 3e-08 gb|AGV40186.2| heparanase 1-like protein [Nicotiana tabacum] 63 5e-08 ref|XP_004235980.1| PREDICTED: heparanase-like protein 1-like [S... 63 5e-08 ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [S... 61 1e-07 ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like is... 58 1e-06 ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like is... 57 2e-06 ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis] gi... 57 3e-06 ref|XP_006374168.1| hypothetical protein POPTR_0015s03440g [Popu... 56 5e-06 ref|XP_006374166.1| hypothetical protein POPTR_0015s03440g [Popu... 56 5e-06 ref|XP_006374165.1| hypothetical protein POPTR_0015s03440g [Popu... 56 5e-06 ref|XP_004157460.1| PREDICTED: heparanase-like protein 1-like [C... 56 5e-06 ref|XP_004137422.1| PREDICTED: heparanase-like protein 1-like [C... 56 5e-06 gb|ABK93116.1| unknown [Populus trichocarpa] 56 5e-06 >gb|EYU43518.1| hypothetical protein MIMGU_mgv1a004063mg [Mimulus guttatus] Length = 546 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PLQ++E GD+P L PA E N+PLS++P+S+KFVVYPNF + GC Sbjct: 502 PLQLTELGDIPSLLPAVNEVNSPLSVSPYSVKFVVYPNFINQGC 545 >gb|AGV40186.2| heparanase 1-like protein [Nicotiana tabacum] Length = 541 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGCK 251 PLQ++E GD+P L P +P+S+AP SIKF+V+PNFNSP C+ Sbjct: 497 PLQLTETGDIPSLTPVLKNIESPISVAPLSIKFIVFPNFNSPSCR 541 >ref|XP_004235980.1| PREDICTED: heparanase-like protein 1-like [Solanum lycopersicum] Length = 540 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 382 LQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 LQ++E GD+P L P N+PLSI P SIKF+V+PNFNSP C Sbjct: 497 LQLTETGDIPSLSPVFTNLNSPLSIEPLSIKFIVFPNFNSPSC 539 >ref|XP_006345162.1| PREDICTED: heparanase-like protein 1-like [Solanum tuberosum] Length = 540 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -2 Query: 382 LQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGCK 251 L+++E GD+P L P N+P+SI P SIKF+V+PNFNSP C+ Sbjct: 497 LRLTETGDIPSLSPVFTNLNSPISIEPLSIKFIVFPNFNSPSCR 540 >ref|XP_006354764.1| PREDICTED: heparanase-like protein 2-like isoform X1 [Solanum tuberosum] gi|565376548|ref|XP_006354765.1| PREDICTED: heparanase-like protein 2-like isoform X2 [Solanum tuberosum] gi|565376550|ref|XP_006354766.1| PREDICTED: heparanase-like protein 2-like isoform X3 [Solanum tuberosum] Length = 538 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/44 (50%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PLQ++E G +P L P + +P+S++P SIKF+V+PNF+SP C Sbjct: 494 PLQLTENGHIPSLSPVLVNLKSPISVSPLSIKFIVFPNFSSPVC 537 >ref|XP_006664141.1| PREDICTED: heparanase-like protein 1-like isoform X1 [Oryza brachyantha] gi|573964035|ref|XP_006664142.1| PREDICTED: heparanase-like protein 1-like isoform X2 [Oryza brachyantha] Length = 539 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/45 (48%), Positives = 33/45 (73%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGCK 251 PLQ++E GD+P L P + N+P+ +AP SI FVV+P+F + GC+ Sbjct: 494 PLQLTENGDIPSLPPVLVSVNSPIYVAPLSITFVVFPDFEAEGCE 538 >ref|XP_002514696.1| Heparanase-2, putative [Ricinus communis] gi|223546300|gb|EEF47802.1| Heparanase-2, putative [Ricinus communis] Length = 539 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PL+++E G++P LDP H +P+ I+P SI F+V+PNF++P C Sbjct: 495 PLELTEDGEIPRLDPVHNNVKSPIYISPLSIAFIVFPNFDAPSC 538 >ref|XP_006374168.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|550321846|gb|ERP51965.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] Length = 362 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PL+++E ++P LDP ++ N+PL I P SI F+V+PNF++P C Sbjct: 318 PLELTEDENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC 361 >ref|XP_006374166.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|550321844|gb|ERP51963.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] Length = 476 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PL+++E ++P LDP ++ N+PL I P SI F+V+PNF++P C Sbjct: 432 PLELTEDENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC 475 >ref|XP_006374165.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|566205614|ref|XP_002321464.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|566205618|ref|XP_006374167.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|550321842|gb|ERP51962.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|550321843|gb|EEF05591.2| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] gi|550321845|gb|ERP51964.1| hypothetical protein POPTR_0015s03440g [Populus trichocarpa] Length = 539 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PL+++E ++P LDP ++ N+PL I P SI F+V+PNF++P C Sbjct: 495 PLELTEDENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC 538 >ref|XP_004157460.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus] Length = 536 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/45 (48%), Positives = 34/45 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGCK 251 PL+++E G++P L+P + N+P+ IAP SI F+V+PNF +P CK Sbjct: 492 PLELTEDGNIPQLNPVLNDVNSPIVIAPLSIAFIVFPNFEAPTCK 536 >ref|XP_004137422.1| PREDICTED: heparanase-like protein 1-like [Cucumis sativus] Length = 536 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/45 (48%), Positives = 34/45 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGCK 251 PL+++E G++P L+P + N+P+ IAP SI F+V+PNF +P CK Sbjct: 492 PLELTEDGNIPQLNPVLNDVNSPIVIAPLSIAFIVFPNFEAPTCK 536 >gb|ABK93116.1| unknown [Populus trichocarpa] Length = 51 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -2 Query: 385 PLQVSERGDVPDLDPAHIETNAPLSIAPFSIKFVVYPNFNSPGC 254 PL+++E ++P LDP ++ N+PL I P SI F+V+PNF++P C Sbjct: 7 PLELTEDENIPSLDPVRLDVNSPLYINPLSISFIVFPNFDAPAC 50