BLASTX nr result
ID: Mentha29_contig00018003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018003 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Mimulus... 55 8e-06 >gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Mimulus guttatus] Length = 337 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +3 Query: 234 MALATVQLRGSYSTSSCLPSARCRGSQLKYLLPSVRVPLVGRKDRLISLKFRSCS 398 MA AT QL+GS ST +PS+ RGS+LK+ P+ VGRKDR ISLK RSCS Sbjct: 1 MASATHQLKGSCSTFPSVPSSWSRGSKLKHFAPTFH--SVGRKDRFISLKCRSCS 53