BLASTX nr result
ID: Mentha29_contig00017563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00017563 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Mimulus... 76 6e-12 gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlise... 74 3e-11 >gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Mimulus guttatus] Length = 273 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 136 MMKIDLSGLDPYEPVRRNVDDSDNEILAAPSFQLPVTADFDGFQK 2 MMKIDLSGLDP P++RN DD DNEILA PSF LP T DFDGFQK Sbjct: 1 MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQK 45 >gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea] Length = 274 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 136 MMKIDLSGLDPYEPVRRNVDDSDNEILAAPSFQLPVTADFDGFQK 2 MMKIDLSGLDP PV+ N DD D+EI+AAPSF+LP T DFDGFQK Sbjct: 2 MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQK 46