BLASTX nr result
ID: Mentha29_contig00016187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00016187 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74557.1| hypothetical protein M569_00204, partial [Genlise... 62 6e-08 >gb|EPS74557.1| hypothetical protein M569_00204, partial [Genlisea aurea] Length = 246 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +1 Query: 307 KAIEPELIEVGTKLLRHPSSTDELLMLLDRAESLLAKVWQQPPRSTCKAL 456 K++E +L VG LL PSSTDELL LL+RAE LL+KVWQQPP+ +AL Sbjct: 1 KSLERDLERVGNSLLSPPSSTDELLNLLERAEGLLSKVWQQPPKRLRRAL 50