BLASTX nr result
ID: Mentha29_contig00015932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00015932 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006390617.1| hypothetical protein EUTSA_v10018411mg [Eutr... 61 2e-07 ref|XP_006600450.1| PREDICTED: threonine synthase 1, chloroplast... 61 2e-07 ref|XP_002521363.1| threonine synthase, putative [Ricinus commun... 61 2e-07 ref|XP_001753413.1| predicted protein [Physcomitrella patens] gi... 61 2e-07 ref|XP_001761514.1| predicted protein [Physcomitrella patens] gi... 61 2e-07 ref|XP_001769453.1| predicted protein [Physcomitrella patens] gi... 61 2e-07 ref|XP_001779566.1| predicted protein [Physcomitrella patens] gi... 61 2e-07 ref|XP_006300050.1| hypothetical protein CARUB_v10016276mg [Caps... 60 2e-07 ref|XP_007154615.1| hypothetical protein PHAVU_003G133700g [Phas... 60 3e-07 ref|NP_565047.1| threonine synthase 2 [Arabidopsis thaliana] gi|... 60 3e-07 ref|XP_006843160.1| hypothetical protein AMTR_s00146p00044900 [A... 60 4e-07 ref|XP_003569607.1| PREDICTED: threonine synthase, chloroplastic... 60 4e-07 ref|XP_004969626.1| PREDICTED: threonine synthase, chloroplastic... 59 5e-07 gb|EMT18574.1| Threonine synthase 2, chloroplastic [Aegilops tau... 59 5e-07 ref|XP_007215680.1| hypothetical protein PRUPE_ppa004050mg [Prun... 59 5e-07 dbj|BAJ87608.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 ref|XP_002888893.1| hypothetical protein ARALYDRAFT_316241 [Arab... 59 5e-07 ref|XP_002458353.1| hypothetical protein SORBIDRAFT_03g031880 [S... 59 5e-07 ref|NP_001149770.1| threonine synthase [Zea mays] gi|195633095|g... 59 5e-07 ref|XP_002285366.1| PREDICTED: threonine synthase, chloroplastic... 59 5e-07 >ref|XP_006390617.1| hypothetical protein EUTSA_v10018411mg [Eutrema salsugineum] gi|557087051|gb|ESQ27903.1| hypothetical protein EUTSA_v10018411mg [Eutrema salsugineum] Length = 515 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NWEV DWVI+PG NLGNIYAFYKG ++ G + Sbjct: 305 IEILQQFNWEVPDWVIIPGGNLGNIYAFYKGFHMCKELGLV 345 >ref|XP_006600450.1| PREDICTED: threonine synthase 1, chloroplastic [Glycine max] gi|83272147|gb|ABC00741.1| threonine synthase [Glycine max] Length = 515 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKIRGSFRFV 344 IEIL Q NWEV DWVIVPG NLGNIYAFYKG ++ G + R V Sbjct: 303 IEILQQFNWEVPDWVIVPGGNLGNIYAFYKGFKMCKELGLVERIPRLV 350 >ref|XP_002521363.1| threonine synthase, putative [Ricinus communis] gi|223539441|gb|EEF41031.1| threonine synthase, putative [Ricinus communis] Length = 531 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG + ++ G + Sbjct: 321 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLV 361 >ref|XP_001753413.1| predicted protein [Physcomitrella patens] gi|162695292|gb|EDQ81636.1| predicted protein [Physcomitrella patens] Length = 468 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG + ++ G + Sbjct: 262 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLV 302 >ref|XP_001761514.1| predicted protein [Physcomitrella patens] gi|162687198|gb|EDQ73582.1| predicted protein [Physcomitrella patens] Length = 514 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG + ++ G + Sbjct: 308 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLV 348 >ref|XP_001769453.1| predicted protein [Physcomitrella patens] gi|162679373|gb|EDQ65822.1| predicted protein [Physcomitrella patens] Length = 477 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG + ++ G + Sbjct: 265 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLV 305 >ref|XP_001779566.1| predicted protein [Physcomitrella patens] gi|162669047|gb|EDQ55642.1| predicted protein [Physcomitrella patens] Length = 472 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG + ++ G + Sbjct: 265 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLV 305 >ref|XP_006300050.1| hypothetical protein CARUB_v10016276mg [Capsella rubella] gi|482568759|gb|EOA32948.1| hypothetical protein CARUB_v10016276mg [Capsella rubella] Length = 521 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NWEV DWVIVPG NLGNIYAFYKG ++ G + Sbjct: 312 IEILQQFNWEVPDWVIVPGGNLGNIYAFYKGFKMCKELGLV 352 >ref|XP_007154615.1| hypothetical protein PHAVU_003G133700g [Phaseolus vulgaris] gi|561027969|gb|ESW26609.1| hypothetical protein PHAVU_003G133700g [Phaseolus vulgaris] Length = 525 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKIRGSFRFV 344 IEIL Q NWEV DWVIVPG NLGNIYAFYKG + G + R V Sbjct: 313 IEILQQFNWEVPDWVIVPGGNLGNIYAFYKGFKMCKDLGLVEKVPRLV 360 >ref|NP_565047.1| threonine synthase 2 [Arabidopsis thaliana] gi|75266272|sp|Q9SSP5.1|THRC2_ARATH RecName: Full=Threonine synthase 2, chloroplastic; Flags: Precursor gi|5903070|gb|AAD55628.1|AC008017_1 Putative threonine synthase [Arabidopsis thaliana] gi|20466326|gb|AAM20480.1| threonine synthase, putative [Arabidopsis thaliana] gi|25084052|gb|AAN72162.1| threonine synthase, putative [Arabidopsis thaliana] gi|332197254|gb|AEE35375.1| threonine synthase 2 [Arabidopsis thaliana] Length = 516 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG ++ G + Sbjct: 307 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFHMCKELGLV 347 >ref|XP_006843160.1| hypothetical protein AMTR_s00146p00044900 [Amborella trichopoda] gi|548845384|gb|ERN04835.1| hypothetical protein AMTR_s00146p00044900 [Amborella trichopoda] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKIRGSFRFV 344 IEIL Q +WEV DWVIVPG NLGNIYAFYKG ++ G + R V Sbjct: 308 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDSIPRLV 355 >ref|XP_003569607.1| PREDICTED: threonine synthase, chloroplastic-like [Brachypodium distachyon] Length = 530 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG R G + Sbjct: 323 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRTLGLV 363 >ref|XP_004969626.1| PREDICTED: threonine synthase, chloroplastic-like [Setaria italica] Length = 525 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG R G + Sbjct: 318 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLV 358 >gb|EMT18574.1| Threonine synthase 2, chloroplastic [Aegilops tauschii] Length = 389 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVI+PG NLGNIYAFYKG R G + Sbjct: 182 IEILQQFNWQVPDWVIIPGGNLGNIYAFYKGFEMCRALGLV 222 >ref|XP_007215680.1| hypothetical protein PRUPE_ppa004050mg [Prunus persica] gi|462411830|gb|EMJ16879.1| hypothetical protein PRUPE_ppa004050mg [Prunus persica] Length = 533 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG ++ G + Sbjct: 322 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLV 362 >dbj|BAJ87608.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 532 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVI+PG NLGNIYAFYKG R G + Sbjct: 325 IEILQQFNWQVPDWVIIPGGNLGNIYAFYKGFEMCRALGLV 365 >ref|XP_002888893.1| hypothetical protein ARALYDRAFT_316241 [Arabidopsis lyrata subsp. lyrata] gi|297334734|gb|EFH65152.1| hypothetical protein ARALYDRAFT_316241 [Arabidopsis lyrata subsp. lyrata] Length = 519 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG ++ G + Sbjct: 310 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFDMCKELGLV 350 >ref|XP_002458353.1| hypothetical protein SORBIDRAFT_03g031880 [Sorghum bicolor] gi|241930328|gb|EES03473.1| hypothetical protein SORBIDRAFT_03g031880 [Sorghum bicolor] Length = 530 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG R G + Sbjct: 323 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLV 363 >ref|NP_001149770.1| threonine synthase [Zea mays] gi|195633095|gb|ACG36731.1| threonine synthase [Zea mays] gi|224028903|gb|ACN33527.1| unknown [Zea mays] gi|414880877|tpg|DAA58008.1| TPA: Threonine synthase [Zea mays] Length = 527 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q NW+V DWVIVPG NLGNIYAFYKG R G + Sbjct: 320 IEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLV 360 >ref|XP_002285366.1| PREDICTED: threonine synthase, chloroplastic [Vitis vinifera] Length = 522 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 201 IEIL*QSNWEVSDWVIVPGRNLGNIYAFYKGNFQLRKFGKI 323 IEIL Q +WEV DWVIVPG NLGNIYAFYKG ++ G + Sbjct: 312 IEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLV 352