BLASTX nr result
ID: Mentha29_contig00015829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00015829 (632 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 84 3e-14 gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indi... 83 8e-14 ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] g... 82 1e-13 ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B-like [B... 82 1e-13 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 80 4e-13 dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] 79 1e-12 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 79 1e-12 gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] 79 1e-12 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 79 1e-12 gb|ACN26849.1| unknown [Zea mays] gi|413917611|gb|AFW57543.1| na... 78 2e-12 ref|NP_001107634.1| LOC100135422 [Zea mays] gi|165881887|gb|ABY7... 78 2e-12 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 77 3e-12 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 77 3e-12 ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [S... 77 3e-12 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 77 3e-12 gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes ... 77 6e-12 gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 77 6e-12 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] 76 7e-12 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 76 7e-12 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 76 9e-12 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 84.3 bits (207), Expect = 3e-14 Identities = 43/71 (60%), Positives = 49/71 (69%), Gaps = 2/71 (2%) Frame = -2 Query: 559 RKKIKKINRET*VKMAGK--ANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIP 386 RKK+ K+ + KMAG A C LGVFLK+GC+ EFWICL+LTLFGYIP Sbjct: 34 RKKVSKLRKSRETKMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIP 93 Query: 385 GIIYAVYAITK 353 GIIYAVYAITK Sbjct: 94 GIIYAVYAITK 104 >gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indica Group] gi|222630128|gb|EEE62260.1| hypothetical protein OsJ_17047 [Oryza sativa Japonica Group] Length = 92 Score = 82.8 bits (203), Expect = 8e-14 Identities = 42/71 (59%), Positives = 46/71 (64%) Frame = -2 Query: 517 MAGKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK*KGLI 338 MAG ANC LGVFLKFGC HEFWICLLLT GYIPGIIYA+YAITK GL Sbjct: 1 MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK-DGLQ 59 Query: 337 SKGHYSKVFLC 305 + + +C Sbjct: 60 TASSIFSIAVC 70 >ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] gi|122169560|sp|Q0DKW8.1|LTI6B_ORYSJ RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|158513180|sp|A2Y075.2|LTI6B_ORYSI RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|21314334|gb|AAM46894.1|AF503583_1 early drought induced protein [Oryza sativa Indica Group] gi|45602865|gb|AAS72306.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group] gi|47717901|gb|AAT37942.1| low temperature-induced low molecular weight integral membrane protein LTI6b [Oryza sativa Japonica Group] gi|113578142|dbj|BAF16505.1| Os05g0138300 [Oryza sativa Japonica Group] Length = 55 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/55 (70%), Positives = 40/55 (72%) Frame = -2 Query: 517 MAGKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 MAG ANC LGVFLKFGC HEFWICLLLT GYIPGIIYA+YAITK Sbjct: 1 MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55 >ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B-like [Brachypodium distachyon] gi|326512942|dbj|BAK03378.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|473882221|gb|EMS48019.1| Hydrophobic protein LTI6B [Triticum urartu] Length = 55 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/55 (70%), Positives = 40/55 (72%) Frame = -2 Query: 517 MAGKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 MAG ANC LGVFLKFGC HEFWICLLLT GYIPGIIYA+YAITK Sbjct: 1 MAGTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGC+ EFWICLLLTLFGYIPGIIYAVYAITK Sbjct: 5 GTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] Length = 54 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/53 (69%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGC HEFWICLLLT GYIPGIIYA+YAITK Sbjct: 2 GTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 54 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 78.6 bits (192), Expect = 1e-12 Identities = 38/53 (71%), Positives = 39/53 (73%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G A C LGVFLKFGCK EFWICLLLT+FGYIPGIIYAVYAITK Sbjct: 5 GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza] Length = 55 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/51 (72%), Positives = 38/51 (74%) Frame = -2 Query: 505 ANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 A C LGVFLKFGCKHEFW+CLLLTL GYIPGIIYAVYAITK Sbjct: 4 ATCIDIIVAIILPPLGVFLKFGCKHEFWLCLLLTLLGYIPGIIYAVYAITK 54 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/53 (69%), Positives = 39/53 (73%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGCK EFW+CLLLT FGY+PGIIYAVYAITK Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVYAITK 56 >gb|ACN26849.1| unknown [Zea mays] gi|413917611|gb|AFW57543.1| naCl stress protein1 [Zea mays] Length = 58 Score = 77.8 bits (190), Expect = 2e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLK+GC HEFWICLLLT GYIPGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIYAITK 56 >ref|NP_001107634.1| LOC100135422 [Zea mays] gi|165881887|gb|ABY71210.1| early drought induced protein [Zea mays] gi|195609864|gb|ACG26762.1| hydrophobic protein LTI6B [Zea mays] gi|195623414|gb|ACG33537.1| hydrophobic protein LTI6B [Zea mays] Length = 58 Score = 77.8 bits (190), Expect = 2e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLK+GC HEFWICLLLT GYIPGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIYAITK 56 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGCK EFWICLLLT GY+PGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGCK EFWICLLLT GY+PGIIYA+YAITK Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor] gi|241945842|gb|EES18987.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor] Length = 57 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGC H+FWICLLLT GY+PGIIYAVYAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCGHQFWICLLLTFLGYLPGIIYAVYAITK 56 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/53 (69%), Positives = 39/53 (73%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G A C LGVFLK+GCK EFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 4 GAATCIDILLAIILPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAVYAITK 56 >gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica] Length = 57 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G A+C LGVFLKFGC HEFWICLLLT GY+PGIIYAVYAITK Sbjct: 5 GTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYLPGIIYAVYAITK 57 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/53 (69%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G A C LGVFLKFGCK EFWICLLLT+ GYIPGIIYAVYAITK Sbjct: 5 GTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 76.3 bits (186), Expect = 7e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G A C LGVFLKFGC+ EFWICLLLTLFGY+PGIIYAVY ITK Sbjct: 5 GSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 76.3 bits (186), Expect = 7e-12 Identities = 36/53 (67%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGC EFWICL+LT FGYIPGIIYA+YAITK Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIYAITK 57 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 75.9 bits (185), Expect = 9e-12 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -2 Query: 511 GKANCXXXXXXXXXXXLGVFLKFGCKHEFWICLLLTLFGYIPGIIYAVYAITK 353 G ANC LGVFLKFGCK EFW+CLLLT GY+PGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAIYAITK 56