BLASTX nr result
ID: Mentha29_contig00015730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00015730 (1115 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS57569.1| Phosphatidylinositol N-acetylglucosaminyltransfer... 64 9e-08 ref|XP_003600604.1| hypothetical protein MTR_3g064150 [Medicago ... 59 5e-06 >gb|EMS57569.1| Phosphatidylinositol N-acetylglucosaminyltransferase subunit A [Triticum urartu] Length = 382 Score = 64.3 bits (155), Expect = 9e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 1023 KVVVPEWLSGMTRNHVGFARAGSNPADHAFF 1115 +VVVPEWLSGMTRNHVGFARAGSNPADH F Sbjct: 341 EVVVPEWLSGMTRNHVGFARAGSNPADHVIF 371 >ref|XP_003600604.1| hypothetical protein MTR_3g064150 [Medicago truncatula] gi|355489652|gb|AES70855.1| hypothetical protein MTR_3g064150 [Medicago truncatula] Length = 50 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1026 VVVPEWLSGMTRNHVGFARAGSNPADHAFF 1115 V VPEWLSGMTRNHVG ARAGSNPA HAFF Sbjct: 6 VDVPEWLSGMTRNHVGSARAGSNPAVHAFF 35