BLASTX nr result
ID: Mentha29_contig00015036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00015036 (454 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525577.1| conserved hypothetical protein [Ricinus comm... 92 6e-17 ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853... 92 8e-17 emb|CBI25807.3| unnamed protein product [Vitis vinifera] 92 8e-17 ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263... 90 3e-16 emb|CBI40627.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249... 90 3e-16 emb|CBI25812.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250... 90 3e-16 emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] 90 3e-16 ref|XP_007010705.1| Uncharacterized protein isoform 2 [Theobroma... 90 4e-16 ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578... 89 5e-16 ref|XP_006361180.1| PREDICTED: uncharacterized protein LOC102578... 89 5e-16 ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814... 89 6e-16 ref|XP_007148777.1| hypothetical protein PHAVU_005G013300g [Phas... 89 8e-16 ref|XP_002275894.2| PREDICTED: uncharacterized protein LOC100264... 88 1e-15 emb|CBI40640.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citr... 88 1e-15 ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citr... 88 1e-15 ref|XP_006849685.1| hypothetical protein AMTR_s00024p00237090 [A... 88 1e-15 ref|XP_004241967.1| PREDICTED: uncharacterized protein LOC101268... 87 2e-15 >ref|XP_002525577.1| conserved hypothetical protein [Ricinus communis] gi|223535156|gb|EEF36836.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAPFV RGLSWFT+KF+F +QGKA AI G C GLAF++F++VTLLWA Sbjct: 180 KLIRAGGALALAPFVDRGLSWFTLKFKFESQGKAFMAIVGFCLGLAFILFLVVTLLWA 237 >ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853368 [Vitis vinifera] Length = 125 Score = 92.0 bits (227), Expect = 8e-17 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA TAI G CFGLA ++F IVTLLWA Sbjct: 68 KLVRAGGALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI25807.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 92.0 bits (227), Expect = 8e-17 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA TAI G CFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 153 >ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263253 [Vitis vinifera] Length = 125 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 68 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI40627.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 25 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 82 >ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249912 [Vitis vinifera] gi|298205097|emb|CBI40618.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 153 >emb|CBI25812.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 156 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 213 >ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250564 [Vitis vinifera] Length = 215 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 158 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 215 >emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] Length = 132 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGKA AI G CFGLA ++F IVTLLWA Sbjct: 75 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 132 >ref|XP_007010705.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508727618|gb|EOY19515.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 243 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAPFV R LSWFT+KF+F +QGKA I G CFGLAF++F++VT+LWA Sbjct: 186 KLVRAGGALALAPFVDRALSWFTVKFKFESQGKASMVIIGFCFGLAFMLFLVVTVLWA 243 >ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578377 isoform X4 [Solanum tuberosum] Length = 179 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 KI+RAGGALALAPFV GLSWFT K +F +QGKA ++G CFGLAF++F+I+TLLWA Sbjct: 122 KIVRAGGALALAPFVDTGLSWFTTKMKFESQGKAFAVVAGFCFGLAFMLFLIITLLWA 179 >ref|XP_006361180.1| PREDICTED: uncharacterized protein LOC102578377 isoform X1 [Solanum tuberosum] gi|565390921|ref|XP_006361181.1| PREDICTED: uncharacterized protein LOC102578377 isoform X2 [Solanum tuberosum] Length = 213 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 KI+RAGGALALAPFV GLSWFT K +F +QGKA ++G CFGLAF++F+I+TLLWA Sbjct: 156 KIVRAGGALALAPFVDTGLSWFTTKMKFESQGKAFAVVAGFCFGLAFMLFLIITLLWA 213 >ref|XP_003522871.1| PREDICTED: uncharacterized protein LOC100814328 [Glycine max] Length = 224 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAPFV RGLSWFT KF+F TQGKA AI G+C GLA ++F ++TLLWA Sbjct: 167 KLVRAGGALALAPFVDRGLSWFTHKFKFQTQGKAFMAIVGLCLGLALIVFFVITLLWA 224 >ref|XP_007148777.1| hypothetical protein PHAVU_005G013300g [Phaseolus vulgaris] gi|561022041|gb|ESW20771.1| hypothetical protein PHAVU_005G013300g [Phaseolus vulgaris] Length = 221 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAPFV RGLSWFT KF+FG+QGKA AI G C LA ++F+++TLLWA Sbjct: 164 KLLRAGGALALAPFVDRGLSWFTDKFKFGSQGKAFMAIVGFCLALALIVFLVITLLWA 221 >ref|XP_002275894.2| PREDICTED: uncharacterized protein LOC100264237 [Vitis vinifera] Length = 121 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGK AI G CFGLA ++F IVTLLWA Sbjct: 64 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKPFMAIVGFCFGLALILFFIVTLLWA 121 >emb|CBI40640.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RAGGALALAP V RGLSWFT+KF+F +QGK AI G CFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKPFMAIVGFCFGLALILFFIVTLLWA 153 >ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|557534453|gb|ESR45571.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 221 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RA GALALAP V RGLSWFT+KF+F TQGKA AI G CFGLA ++F+ VTLLWA Sbjct: 164 KLVRAAGALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 221 >ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|568834248|ref|XP_006471257.1| PREDICTED: uncharacterized protein LOC102618398 [Citrus sinensis] gi|557534452|gb|ESR45570.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 230 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 K++RA GALALAP V RGLSWFT+KF+F TQGKA AI G CFGLA ++F+ VTLLWA Sbjct: 173 KLVRAAGALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 230 >ref|XP_006849685.1| hypothetical protein AMTR_s00024p00237090 [Amborella trichopoda] gi|548853260|gb|ERN11266.1| hypothetical protein AMTR_s00024p00237090 [Amborella trichopoda] Length = 216 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 KI RAGGAL LAPFV RGLSWFT KFRF ++GKA AI+GICFGLA L+F++VT+L A Sbjct: 159 KIARAGGALVLAPFVDRGLSWFTKKFRFSSRGKAFAAIAGICFGLALLLFIVVTVLCA 216 >ref|XP_004241967.1| PREDICTED: uncharacterized protein LOC101268479 [Solanum lycopersicum] Length = 210 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = +2 Query: 2 KIMRAGGALALAPFVLRGLSWFTIKFRFGTQGKAVTAISGICFGLAFLMFVIVTLLWA 175 KI+RAGGALALAPFV GLSWFT K +F +QGKA ++G CF LAF++F+IVTLLWA Sbjct: 153 KIVRAGGALALAPFVDTGLSWFTTKMKFKSQGKAFAVVAGFCFSLAFMLFLIVTLLWA 210