BLASTX nr result
ID: Mentha29_contig00014000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00014000 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45473.1| hypothetical protein MIMGU_mgv1a016804mg [Mimulus... 62 6e-08 ref|NP_001235728.1| uncharacterized protein LOC100305974 [Glycin... 61 2e-07 ref|XP_007137199.1| hypothetical protein PHAVU_009G108000g [Phas... 59 5e-07 ref|XP_003526484.1| PREDICTED: probable protein Pop3-like [Glyci... 59 5e-07 ref|NP_566569.1| heat stable protein 1 [Arabidopsis thaliana] gi... 59 7e-07 pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidops... 59 7e-07 gb|AAM63750.1| pop3 peptide [Arabidopsis thaliana] 59 7e-07 gb|EXB75674.1| hypothetical protein L484_026152 [Morus notabilis] 59 9e-07 ref|XP_006378196.1| hypothetical protein POPTR_0010s04700g [Popu... 58 1e-06 ref|XP_002280639.1| PREDICTED: probable protein Pop3 [Vitis vini... 58 2e-06 ref|XP_002272048.1| PREDICTED: probable protein Pop3 [Vitis vini... 57 2e-06 gb|EYU45475.1| hypothetical protein MIMGU_mgv1a024900mg, partial... 57 3e-06 gb|EYU45474.1| hypothetical protein MIMGU_mgv1a016769mg [Mimulus... 57 3e-06 ref|XP_006378193.1| Pop3 family protein [Populus trichocarpa] gi... 57 3e-06 ref|XP_006298852.1| hypothetical protein CARUB_v10014967mg [Caps... 57 3e-06 pdb|1Q4R|A Chain A, Gene Product Of At3g17210 From Arabidopsis T... 57 3e-06 ref|XP_006488787.1| PREDICTED: probable protein Pop3-like [Citru... 57 3e-06 ref|XP_006419297.1| hypothetical protein CICLE_v10006242mg [Citr... 57 3e-06 ref|XP_002883054.1| hypothetical protein ARALYDRAFT_479193 [Arab... 56 4e-06 ref|XP_004295037.1| PREDICTED: probable protein Pop3-like [Fraga... 56 6e-06 >gb|EYU45473.1| hypothetical protein MIMGU_mgv1a016804mg [Mimulus guttatus] Length = 106 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 179 KGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 +GEVKH+LLAKFK G++E IEEYIK+YANLVNLVP Sbjct: 2 EGEVKHILLAKFKQGITEDQIEEYIKQYANLVNLVP 37 >ref|NP_001235728.1| uncharacterized protein LOC100305974 [Glycine max] gi|255627155|gb|ACU13922.1| unknown [Glycine max] Length = 109 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE KG VKH+LLAKFKD ++ + IEE IK+YANLVNL+P Sbjct: 1 MEEAKGVVKHVLLAKFKDDVTPERIEELIKDYANLVNLIP 40 >ref|XP_007137199.1| hypothetical protein PHAVU_009G108000g [Phaseolus vulgaris] gi|561010286|gb|ESW09193.1| hypothetical protein PHAVU_009G108000g [Phaseolus vulgaris] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE KG VKH++LAKFKD ++ + IEE IK YANLVNLVP Sbjct: 1 MEEAKGVVKHIVLAKFKDDITAEKIEELIKGYANLVNLVP 40 >ref|XP_003526484.1| PREDICTED: probable protein Pop3-like [Glycine max] Length = 109 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE KG VKH+ LAKFKD ++ + IEE IK+YANLVNL+P Sbjct: 1 MEEAKGVVKHVFLAKFKDDVTPERIEELIKDYANLVNLIP 40 >ref|NP_566569.1| heat stable protein 1 [Arabidopsis thaliana] gi|51316534|sp|Q9LUV2.1|POP3_ARATH RecName: Full=Probable protein Pop3 gi|13877523|gb|AAK43839.1|AF370462_1 Unknown protein [Arabidopsis thaliana] gi|11994536|dbj|BAB02723.1| unnamed protein product [Arabidopsis thaliana] gi|17978771|gb|AAL47379.1| unknown protein [Arabidopsis thaliana] gi|110741422|dbj|BAF02259.1| hypothetical protein [Arabidopsis thaliana] gi|332642400|gb|AEE75921.1| heat stable protein 1 [Arabidopsis thaliana] Length = 109 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG VKH+LLA FKDG+S + IEE IK YANLVNL+ Sbjct: 1 MEEAKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLI 39 >pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 gi|159162872|pdb|1Q53|B Chain B, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 Length = 112 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG VKH+LLA FKDG+S + IEE IK YANLVNL+ Sbjct: 4 MEEAKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLI 42 >gb|AAM63750.1| pop3 peptide [Arabidopsis thaliana] Length = 109 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG VKH+LLA FKDG+S + IEE IK YANLVNL+ Sbjct: 1 MEEAKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLI 39 >gb|EXB75674.1| hypothetical protein L484_026152 [Morus notabilis] Length = 110 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG +KH+LLAKFK+G+SE+ IE+ IK YANLVNL+ Sbjct: 1 MEEVKGVLKHVLLAKFKEGVSEEEIEKLIKGYANLVNLI 39 >ref|XP_006378196.1| hypothetical protein POPTR_0010s04700g [Populus trichocarpa] gi|550329068|gb|ERP55993.1| hypothetical protein POPTR_0010s04700g [Populus trichocarpa] Length = 138 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 161 IVMEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 +VMEE KG VKH+LLAKFK+G+ IE+ IK YANLVNL+ Sbjct: 28 VVMEEAKGVVKHVLLAKFKEGIPSDEIEKLIKGYANLVNLI 68 >ref|XP_002280639.1| PREDICTED: probable protein Pop3 [Vitis vinifera] gi|296083200|emb|CBI22836.3| unnamed protein product [Vitis vinifera] Length = 109 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE KG VKH+LLAKFKD IEE IK YANLVNLVP Sbjct: 1 MEEAKGVVKHVLLAKFKDSTPPDQIEELIKGYANLVNLVP 40 >ref|XP_002272048.1| PREDICTED: probable protein Pop3 [Vitis vinifera] gi|296083186|emb|CBI22822.3| unnamed protein product [Vitis vinifera] Length = 109 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE KG VKH+LLAKFKD IEE IK YANLVNLVP Sbjct: 1 MEEAKGLVKHVLLAKFKDSTPPDQIEELIKGYANLVNLVP 40 >gb|EYU45475.1| hypothetical protein MIMGU_mgv1a024900mg, partial [Mimulus guttatus] Length = 106 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 179 KGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 K EVKH+LLAK K G+SE IE YIK+YANLVNLVP Sbjct: 2 KHEVKHMLLAKLKQGISEDEIEGYIKQYANLVNLVP 37 >gb|EYU45474.1| hypothetical protein MIMGU_mgv1a016769mg [Mimulus guttatus] Length = 107 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLVP 286 MEE GEVKH++LAKFK+ +SE+ I+E IK+YANLVNLVP Sbjct: 1 MEE--GEVKHIVLAKFKESVSEEEIQESIKQYANLVNLVP 38 >ref|XP_006378193.1| Pop3 family protein [Populus trichocarpa] gi|550329065|gb|ERP55990.1| Pop3 family protein [Populus trichocarpa] Length = 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +2 Query: 161 IVMEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 ++MEE KG VKH+LLAKFK+G+ IE+ IK YANLVNL+ Sbjct: 53 VLMEEAKGVVKHVLLAKFKEGIPSDEIEKLIKGYANLVNLI 93 >ref|XP_006298852.1| hypothetical protein CARUB_v10014967mg [Capsella rubella] gi|482567561|gb|EOA31750.1| hypothetical protein CARUB_v10014967mg [Capsella rubella] Length = 110 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 170 EETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 E KG VKH+LLAKFKDG+S + IEE IK YANLVNL+ Sbjct: 3 EANKGPVKHILLAKFKDGVSPEKIEELIKGYANLVNLI 40 >pdb|1Q4R|A Chain A, Gene Product Of At3g17210 From Arabidopsis Thaliana gi|150261453|pdb|2Q3P|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of At3g17210 From Arabidopsis Thaliana Length = 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 170 EETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 EE KG VKH+LLA FKDG+S + IEE IK YANLVNL+ Sbjct: 5 EEAKGPVKHVLLASFKDGVSPEKIEELIKGYANLVNLI 42 >ref|XP_006488787.1| PREDICTED: probable protein Pop3-like [Citrus sinensis] Length = 109 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG VKH+LLAKFK+G ++ I++ IK+YANLVNL+ Sbjct: 1 MEEAKGVVKHVLLAKFKEGTAQDQIDQLIKDYANLVNLI 39 >ref|XP_006419297.1| hypothetical protein CICLE_v10006242mg [Citrus clementina] gi|557521170|gb|ESR32537.1| hypothetical protein CICLE_v10006242mg [Citrus clementina] Length = 118 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE KG VKH+LLAKFK+G ++ I++ IK+YANLVNL+ Sbjct: 10 MEEAKGVVKHVLLAKFKEGTAQDQIDQLIKDYANLVNLI 48 >ref|XP_002883054.1| hypothetical protein ARALYDRAFT_479193 [Arabidopsis lyrata subsp. lyrata] gi|297328894|gb|EFH59313.1| hypothetical protein ARALYDRAFT_479193 [Arabidopsis lyrata subsp. lyrata] Length = 110 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 167 MEETKGEV-KHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 M E KG V KH+LLAKFKDG+S +TIEE IK YANLVNL+ Sbjct: 1 MAEAKGAVVKHVLLAKFKDGVSPETIEELIKGYANLVNLI 40 >ref|XP_004295037.1| PREDICTED: probable protein Pop3-like [Fragaria vesca subsp. vesca] Length = 109 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 167 MEETKGEVKHLLLAKFKDGLSEQTIEEYIKEYANLVNLV 283 MEE G VKH+LL KFK+G+SE I++ IK+YANLVNL+ Sbjct: 1 MEEAMGVVKHVLLVKFKEGVSESEIDQLIKDYANLVNLI 39