BLASTX nr result
ID: Mentha29_contig00013592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00013592 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22462.1| hypothetical protein MIMGU_mgv1a018530mg [Mimulus... 63 4e-08 >gb|EYU22462.1| hypothetical protein MIMGU_mgv1a018530mg [Mimulus guttatus] Length = 415 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 187 SAATAPANYHCLATLKAHSSYVFSLALAGKHLYSGAS 297 +A +A A++HCLATLK HSSY+FSL+LAGKHLYSGAS Sbjct: 49 AATSAAAHHHCLATLKGHSSYIFSLSLAGKHLYSGAS 85