BLASTX nr result
ID: Mentha29_contig00012731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00012731 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231759.1| PREDICTED: membrane-anchored ubiquitin-fold ... 59 9e-07 >ref|XP_004231759.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4-like isoform 1 [Solanum lycopersicum] Length = 127 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -2 Query: 229 KCKMPFGELLKGIITMHVVVQPSLAKAKTGNT*LTINK*SSF*CFE 92 +CK PFGEL GIITMH VVQPSLAKAK+G L N S + CFE Sbjct: 72 QCKTPFGELPNGIITMHAVVQPSLAKAKSGRFPLLRNMFSFYVCFE 117