BLASTX nr result
ID: Mentha29_contig00012340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00012340 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38508.1| hypothetical protein MIMGU_mgv1a016006mg [Mimulus... 62 8e-08 >gb|EYU38508.1| hypothetical protein MIMGU_mgv1a016006mg [Mimulus guttatus] Length = 137 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/55 (61%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = +2 Query: 131 MDIRPRIGSIYSHTCLNLASNSI--FLRPRCSKAPPPQQSGDDKNN--GDKSSRD 283 MDIR RI S+YSH N SNS L+P C+K PPPQQ+GD NN GDKSSRD Sbjct: 1 MDIRLRIESLYSHQSWNSNSNSNQRILKPSCAKKPPPQQNGDTNNNNKGDKSSRD 55