BLASTX nr result
ID: Mentha29_contig00012205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00012205 (833 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago ... 62 3e-07 ref|XP_003624943.1| hypothetical protein MTR_7g089270 [Medicago ... 60 1e-06 >ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago truncatula] gi|355513770|gb|AES95393.1| hypothetical protein MTR_5g024980 [Medicago truncatula] Length = 286 Score = 62.0 bits (149), Expect = 3e-07 Identities = 37/73 (50%), Positives = 50/73 (68%) Frame = +2 Query: 116 LSDSCRAISVGRKPNKERSSTALVTQ*LSPLSAVNHALTRQP*FINQTWFPISLELKDIE 295 +S +++ +GR ERSSTA + + AVNHAL + FI+QT+ P+SLE+KD Sbjct: 1 MSSLGKSVELGR----ERSSTAEDDAHI--ILAVNHALITRSWFIHQTYVPVSLEIKDTV 54 Query: 296 VRAYRTDPVQVRS 334 VR+YRTDPVQVRS Sbjct: 55 VRSYRTDPVQVRS 67 >ref|XP_003624943.1| hypothetical protein MTR_7g089270 [Medicago truncatula] gi|355499958|gb|AES81161.1| hypothetical protein MTR_7g089270 [Medicago truncatula] Length = 95 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +2 Query: 200 SPLSAVNHALTRQP*FINQTWFPISLELKDIEVRAYRTDPVQVRS 334 +P +AVNHAL + FI QT+ P+SLE+KD VR+YRTDPVQVRS Sbjct: 51 NPPTAVNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDPVQVRS 95