BLASTX nr result
ID: Mentha29_contig00012165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00012165 (859 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prun... 51 4e-06 >ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] gi|462401284|gb|EMJ06841.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] Length = 282 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 727 LQYVSSFDGLTVSGNHFRRVRDVDMKRDYAFVSFS 831 L+Y+S+ D LTVSGN RRVRDVDMKR++AFV FS Sbjct: 3 LKYLSN-DSLTVSGNRLRRVRDVDMKREFAFVEFS 36 Score = 26.9 bits (58), Expect(2) = 4e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 821 FPFQEFSDPRDAD 859 F F EFSDPRDAD Sbjct: 30 FAFVEFSDPRDAD 42