BLASTX nr result
ID: Mentha29_contig00011938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00011938 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40275.1| hypothetical protein MIMGU_mgv1a026313mg [Mimulus... 84 2e-14 ref|XP_007209140.1| hypothetical protein PRUPE_ppa005798mg [Prun... 73 5e-11 ref|XP_006345124.1| PREDICTED: presenilin-like protein At2g29900... 72 8e-11 ref|XP_004236050.1| PREDICTED: presenilin-like protein At2g29900... 72 8e-11 ref|XP_004236049.1| PREDICTED: presenilin-like protein At2g29900... 72 8e-11 ref|XP_004299299.1| PREDICTED: presenilin-like protein At2g29900... 71 2e-10 gb|EXC04884.1| Presenilin-like protein [Morus notabilis] 68 2e-09 ref|XP_006374407.1| Presenilin-like family protein [Populus tric... 67 2e-09 emb|CBI15118.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002284021.1| PREDICTED: presenilin-like protein At2g29900... 66 4e-09 ref|XP_004157449.1| PREDICTED: presenilin-like protein At2g29900... 66 6e-09 ref|XP_004157448.1| PREDICTED: presenilin-like protein At2g29900... 66 6e-09 ref|XP_004137433.1| PREDICTED: presenilin-like protein At2g29900... 66 6e-09 ref|XP_004137432.1| PREDICTED: presenilin-like protein At2g29900... 66 6e-09 ref|XP_006477674.1| PREDICTED: presenilin-like protein At2g29900... 65 1e-08 ref|XP_007037576.1| Presenilin-2 [Theobroma cacao] gi|508774821|... 65 1e-08 ref|XP_002514654.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|NP_180551.1| Presenilin-2 [Arabidopsis thaliana] gi|37082576... 62 6e-08 ref|XP_006410038.1| hypothetical protein EUTSA_v10016742mg [Eutr... 62 1e-07 ref|XP_006294331.1| hypothetical protein CARUB_v10023339mg [Caps... 62 1e-07 >gb|EYU40275.1| hypothetical protein MIMGU_mgv1a026313mg [Mimulus guttatus] Length = 399 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 ME+NPRP+++LE CGEEIIRIVTPVSICM+LVVILVSILNGDS+++ S TM Sbjct: 1 MEQNPRPRSVLEVCGEEIIRIVTPVSICMVLVVILVSILNGDSSSNLSSITTM 53 >ref|XP_007209140.1| hypothetical protein PRUPE_ppa005798mg [Prunus persica] gi|462404875|gb|EMJ10339.1| hypothetical protein PRUPE_ppa005798mg [Prunus persica] Length = 443 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADD 274 M +NPRP TILE+ GEE+IRI+TPVSICMLLVVILV+ILN DS++ + Sbjct: 1 MAQNPRPTTILESLGEELIRIITPVSICMLLVVILVTILNADSSSSE 47 >ref|XP_006345124.1| PREDICTED: presenilin-like protein At2g29900-like [Solanum tuberosum] Length = 431 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/53 (62%), Positives = 45/53 (84%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+EN +P+++L++ GEEI+RIVTPVSICMLLVVILVS+LN DS + SF ++ Sbjct: 1 MDENSKPRSVLDSLGEEIVRIVTPVSICMLLVVILVSVLNNDSDSSGPSFTSI 53 >ref|XP_004236050.1| PREDICTED: presenilin-like protein At2g29900-like isoform 2 [Solanum lycopersicum] Length = 411 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/53 (62%), Positives = 45/53 (84%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+EN +P+++L++ GEEI+RIVTPVSICMLLVVILVS+LN DS + SF ++ Sbjct: 1 MDENSKPRSVLDSLGEEIVRIVTPVSICMLLVVILVSVLNNDSDSSGPSFTSI 53 >ref|XP_004236049.1| PREDICTED: presenilin-like protein At2g29900-like isoform 1 [Solanum lycopersicum] Length = 437 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/53 (62%), Positives = 45/53 (84%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+EN +P+++L++ GEEI+RIVTPVSICMLLVVILVS+LN DS + SF ++ Sbjct: 1 MDENSKPRSVLDSLGEEIVRIVTPVSICMLLVVILVSVLNNDSDSSGPSFTSI 53 >ref|XP_004299299.1| PREDICTED: presenilin-like protein At2g29900-like [Fragaria vesca subsp. vesca] Length = 429 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/53 (64%), Positives = 43/53 (81%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M +NPRP +ILET GEE++RI+TPVSICM LVVILVS+L+ DS+ S AT+ Sbjct: 1 MAQNPRPTSILETLGEELVRIITPVSICMFLVVILVSVLSSDSSVTVNSVATI 53 >gb|EXC04884.1| Presenilin-like protein [Morus notabilis] Length = 438 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M + PRP+++LE+ GEEIIRI+TPVSICM +VVILVSIL DS+ S AT+ Sbjct: 1 MAQIPRPRSVLESLGEEIIRIITPVSICMFMVVILVSILTSDSSTTVSSIATI 53 >ref|XP_006374407.1| Presenilin-like family protein [Populus trichocarpa] gi|550322169|gb|ERP52204.1| Presenilin-like family protein [Populus trichocarpa] Length = 408 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M +N RPK++L++ GEE++RI+TPVSICM LVV+LVSILN DS++ S T+ Sbjct: 1 MAQNRRPKSVLDSLGEELVRIITPVSICMFLVVVLVSILNTDSSSSASSINTI 53 >emb|CBI15118.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/60 (53%), Positives = 47/60 (78%) Frame = +2 Query: 113 NPAILD*MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 +P I M +N RP++I+E+ GEEIIRI++PVSICM LVV+LV+ILN D+++ S +T+ Sbjct: 26 DPKIGTPMAQNRRPRSIIESLGEEIIRIISPVSICMFLVVLLVTILNSDTSSSSSSVSTI 85 >ref|XP_002284021.1| PREDICTED: presenilin-like protein At2g29900-like [Vitis vinifera] Length = 410 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/53 (56%), Positives = 44/53 (83%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M +N RP++I+E+ GEEIIRI++PVSICM LVV+LV+ILN D+++ S +T+ Sbjct: 1 MAQNRRPRSIIESLGEEIIRIISPVSICMFLVVLLVTILNSDTSSSSSSVSTI 53 >ref|XP_004157449.1| PREDICTED: presenilin-like protein At2g29900-like isoform 2 [Cucumis sativus] Length = 412 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M EN RP +ILE+ GEEI+RIVTPVSICM +VVILVSILN +S++ S ++ Sbjct: 1 MAENQRPTSILESLGEEIVRIVTPVSICMFMVVILVSILNPNSSSSYASVGSI 53 >ref|XP_004157448.1| PREDICTED: presenilin-like protein At2g29900-like isoform 1 [Cucumis sativus] Length = 437 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M EN RP +ILE+ GEEI+RIVTPVSICM +VVILVSILN +S++ S ++ Sbjct: 1 MAENQRPTSILESLGEEIVRIVTPVSICMFMVVILVSILNPNSSSSYASVGSI 53 >ref|XP_004137433.1| PREDICTED: presenilin-like protein At2g29900-like isoform 2 [Cucumis sativus] Length = 417 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M EN RP +ILE+ GEEI+RIVTPVSICM +VVILVSILN +S++ S ++ Sbjct: 1 MAENQRPTSILESLGEEIVRIVTPVSICMFMVVILVSILNPNSSSSYASVGSI 53 >ref|XP_004137432.1| PREDICTED: presenilin-like protein At2g29900-like isoform 1 [Cucumis sativus] Length = 437 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M EN RP +ILE+ GEEI+RIVTPVSICM +VVILVSILN +S++ S ++ Sbjct: 1 MAENQRPTSILESLGEEIVRIVTPVSICMFMVVILVSILNPNSSSSYASVGSI 53 >ref|XP_006477674.1| PREDICTED: presenilin-like protein At2g29900-like [Citrus sinensis] Length = 433 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M +N RP +IL+T GEEI+RI+TPVSICML+VVILVSIL+ D ++ + T+ Sbjct: 1 MAQNQRPASILDTLGEEIVRIITPVSICMLMVVILVSILSLDDSSSSSAMPTI 53 >ref|XP_007037576.1| Presenilin-2 [Theobroma cacao] gi|508774821|gb|EOY22077.1| Presenilin-2 [Theobroma cacao] Length = 420 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M +N PKT+L++ GEEIIRI+TPVSICM LVV+LVS LN +S+ S AT+ Sbjct: 1 MAQNQGPKTLLDSLGEEIIRILTPVSICMFLVVLLVSTLNSNSSTSVASIATI 53 >ref|XP_002514654.1| conserved hypothetical protein [Ricinus communis] gi|223546258|gb|EEF47760.1| conserved hypothetical protein [Ricinus communis] Length = 357 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILN 253 M +N RP++I+++ GEEIIRI+TPVSICML+VV+LVSILN Sbjct: 1 MAQNQRPRSIIDSLGEEIIRIITPVSICMLIVVVLVSILN 40 >ref|NP_180551.1| Presenilin-2 [Arabidopsis thaliana] gi|37082576|sp|Q9SIK7.1|PSNB_ARATH RecName: Full=Presenilin-like protein At2g29900 gi|4567215|gb|AAD23630.1| putative presenilin [Arabidopsis thaliana] gi|114050623|gb|ABI49461.1| At2g29900 [Arabidopsis thaliana] gi|330253224|gb|AEC08318.1| Presenilin-2 [Arabidopsis thaliana] Length = 397 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/53 (52%), Positives = 41/53 (77%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+ N RP++IL++ GEE+I I+TPVSICM VV+LV ILN D ++ SF+++ Sbjct: 1 MDRNQRPRSILDSLGEELIAILTPVSICMFTVVLLVCILNSDPSSSSASFSSI 53 >ref|XP_006410038.1| hypothetical protein EUTSA_v10016742mg [Eutrema salsugineum] gi|557111207|gb|ESQ51491.1| hypothetical protein EUTSA_v10016742mg [Eutrema salsugineum] Length = 405 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+ N RP++IL++ GEE+I I+TPVSICM VV+LV +LN D ++ SF+++ Sbjct: 1 MDRNQRPRSILDSLGEELIGILTPVSICMFTVVLLVCVLNSDPSSSSASFSSI 53 >ref|XP_006294331.1| hypothetical protein CARUB_v10023339mg [Capsella rubella] gi|482563039|gb|EOA27229.1| hypothetical protein CARUB_v10023339mg [Capsella rubella] Length = 405 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +2 Query: 134 MEENPRPKTILETCGEEIIRIVTPVSICMLLVVILVSILNGDSTADDLSFATM 292 M+ N RP+++L++ GEE+I I+TPVSICM VV+LV ILN D ++ SF+++ Sbjct: 1 MDRNQRPRSLLDSLGEELIAILTPVSICMFTVVLLVCILNSDPSSSSASFSSI 53