BLASTX nr result
ID: Mentha29_contig00011885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00011885 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27678.1| hypothetical protein MIMGU_mgv1a003969mg [Mimulus... 61 1e-07 ref|NP_001234305.1| GRAS1 protein [Solanum lycopersicum] gi|8947... 57 3e-06 ref|XP_004236663.1| PREDICTED: scarecrow-like protein 13-like is... 55 8e-06 >gb|EYU27678.1| hypothetical protein MIMGU_mgv1a003969mg [Mimulus guttatus] Length = 552 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 37 NMLKEYSSNYNIADFGNGALYLGWKNRALATISAWK 144 +MLKEYSSNY +A+ GNGALYLGWKNRAL+T SAW+ Sbjct: 518 DMLKEYSSNYRLAE-GNGALYLGWKNRALSTSSAWR 552 >ref|NP_001234305.1| GRAS1 protein [Solanum lycopersicum] gi|89474462|gb|ABD72958.1| GRAS1 [Solanum lycopersicum] Length = 542 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 37 NMLKEYSSNYNIADFGNGALYLGWKNRALATISAWK 144 +MLKEYS NY A+ G GALYLGWKNRALAT SAW+ Sbjct: 508 HMLKEYSPNYRYAE-GEGALYLGWKNRALATSSAWR 542 >ref|XP_004236663.1| PREDICTED: scarecrow-like protein 13-like isoform 1 [Solanum lycopersicum] gi|460381870|ref|XP_004236664.1| PREDICTED: scarecrow-like protein 13-like isoform 2 [Solanum lycopersicum] Length = 553 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +1 Query: 40 MLKEYSSNYNIADFGNGALYLGWKNRALATISAWK*TH 153 MLKEYSSNY +A+ GALY+GW NRALAT SAW+ H Sbjct: 511 MLKEYSSNYKLAE-SQGALYIGWNNRALATSSAWQLPH 547