BLASTX nr result
ID: Mentha29_contig00010621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010621 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28949.1| hypothetical protein MIMGU_mgv1a016906mg [Mimulus... 107 1e-21 gb|EPS73260.1| hypothetical protein M569_01499 [Genlisea aurea] 107 1e-21 gb|EPS73259.1| hypothetical protein M569_01498 [Genlisea aurea] 107 1e-21 ref|XP_007034223.1| Ribosomal protein L6 family protein [Theobro... 107 1e-21 ref|XP_002310235.1| hypothetical protein POPTR_0007s12890g [Popu... 107 1e-21 ref|XP_004496128.1| PREDICTED: 60S ribosomal protein L6, mitocho... 105 5e-21 ref|XP_007144238.1| hypothetical protein PHAVU_007G139500g [Phas... 105 6e-21 ref|XP_007202741.1| hypothetical protein PRUPE_ppa013193mg [Prun... 105 6e-21 ref|XP_007202740.1| hypothetical protein PRUPE_ppa013193mg [Prun... 105 6e-21 ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitocho... 105 6e-21 ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus ... 105 6e-21 gb|AFK46285.1| unknown [Medicago truncatula] 104 1e-20 emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] 104 1e-20 gb|EXC30991.1| 60S ribosomal protein L6 [Morus notabilis] 104 1e-20 ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitocho... 104 1e-20 ref|NP_001239835.1| uncharacterized protein LOC100811303 [Glycin... 104 1e-20 ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitocho... 104 1e-20 ref|NP_001235881.1| uncharacterized protein LOC100527168 [Glycin... 103 2e-20 ref|XP_004232407.1| PREDICTED: 60S ribosomal protein L6, mitocho... 103 2e-20 gb|ACU15415.1| unknown [Glycine max] 103 3e-20 >gb|EYU28949.1| hypothetical protein MIMGU_mgv1a016906mg [Mimulus guttatus] gi|604336375|gb|EYU40160.1| hypothetical protein MIMGU_mgv1a016908mg [Mimulus guttatus] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAEAEGRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >gb|EPS73260.1| hypothetical protein M569_01499 [Genlisea aurea] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAEAEGRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >gb|EPS73259.1| hypothetical protein M569_01498 [Genlisea aurea] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAEAEGRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|XP_007034223.1| Ribosomal protein L6 family protein [Theobroma cacao] gi|508713252|gb|EOY05149.1| Ribosomal protein L6 family protein [Theobroma cacao] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEAEGRLLFLKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|XP_002310235.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|566181018|ref|XP_006380761.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|566181021|ref|XP_006380762.1| ribosomal protein L6 [Populus trichocarpa] gi|118485475|gb|ABK94593.1| unknown [Populus trichocarpa] gi|118486815|gb|ABK95242.1| unknown [Populus trichocarpa] gi|222853138|gb|EEE90685.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|550334757|gb|ERP58558.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|550334758|gb|ERP58559.1| ribosomal protein L6 [Populus trichocarpa] Length = 102 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEAEGRLLFLKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|XP_004496128.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cicer arietinum] Length = 102 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAE+ GRLL+LKLGYSHEVELAAPPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAESAGRLLYLKLGYSHEVELAAPPAVRVFCFKNNVI 55 >ref|XP_007144238.1| hypothetical protein PHAVU_007G139500g [Phaseolus vulgaris] gi|561017428|gb|ESW16232.1| hypothetical protein PHAVU_007G139500g [Phaseolus vulgaris] Length = 102 Score = 105 bits (262), Expect = 6e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEA GRLL+LKLGYSHEVELA PPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELAVPPAVRVFCFKNNVI 55 >ref|XP_007202741.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] gi|462398272|gb|EMJ03940.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] Length = 135 Score = 105 bits (262), Expect = 6e-21 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEAEGRLL LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 34 MEAKFFRFLKIVGVGYKARAEAEGRLLLLKLGYSHEVELTVPPAVRVFCFKNNVV 88 >ref|XP_007202740.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] gi|462398271|gb|EMJ03939.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] Length = 102 Score = 105 bits (262), Expect = 6e-21 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEAEGRLL LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLLLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Glycine max] Length = 102 Score = 105 bits (262), Expect = 6e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEA GRLL+LKLGYSHEVELA PPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELAVPPAVRVFCFKNNVI 55 >ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus communis] gi|223533110|gb|EEF34868.1| 50S ribosomal protein L6, putative [Ricinus communis] Length = 102 Score = 105 bits (262), Expect = 6e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAE+EGRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >gb|AFK46285.1| unknown [Medicago truncatula] Length = 102 Score = 104 bits (260), Expect = 1e-20 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAE+ GRLL+LKLGYSHEVEL+APPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAESAGRLLYLKLGYSHEVELSAPPAVRVFCFKNNVI 55 >emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] Length = 102 Score = 104 bits (260), Expect = 1e-20 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAE+EGRLLFLKLGYSHEVEL PPAVRVFCFK NVV Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNVV 55 >gb|EXC30991.1| 60S ribosomal protein L6 [Morus notabilis] Length = 102 Score = 104 bits (259), Expect = 1e-20 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAE++GRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAESQGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] gi|449496483|ref|XP_004160146.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] Length = 102 Score = 104 bits (259), Expect = 1e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEA GRLL+LKLGYSHEVEL PPAVRVFCFKNNVV Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVV 55 >ref|NP_001239835.1| uncharacterized protein LOC100811303 [Glycine max] gi|255634114|gb|ACU17420.1| unknown [Glycine max] Length = 102 Score = 104 bits (259), Expect = 1e-20 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEA GRLL+LKLGYSH+VELA PPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHDVELAVPPAVRVFCFKNNVI 55 >ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitochondrial [Vitis vinifera] gi|297735153|emb|CBI17515.3| unnamed protein product [Vitis vinifera] Length = 102 Score = 104 bits (259), Expect = 1e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAE+EGRLLFLKLGYSHEVEL PPAVRVFCFK N+V Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNIV 55 >ref|NP_001235881.1| uncharacterized protein LOC100527168 [Glycine max] gi|255631702|gb|ACU16218.1| unknown [Glycine max] Length = 102 Score = 103 bits (258), Expect = 2e-20 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVG+KARAEA GRLL+LKLGYSHEVEL PPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVI 55 >ref|XP_004232407.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Solanum lycopersicum] gi|565347196|ref|XP_006340619.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Solanum tuberosum] Length = 102 Score = 103 bits (257), Expect = 2e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFLKIVGVGFKARAE+EGRLL+LKLGYSHEVEL PPAVRVFCFK NVV Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNVV 55 >gb|ACU15415.1| unknown [Glycine max] Length = 102 Score = 103 bits (256), Expect = 3e-20 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +1 Query: 88 MEAKFFRFLKIVGVGFKARAEAEGRLLFLKLGYSHEVELAAPPAVRVFCFKNNVV 252 MEAKFFRFL+IVGVG+KARAEA GRLL+LKLGYSH+VELA PPAVRVFCFKNNV+ Sbjct: 1 MEAKFFRFLRIVGVGYKARAEAAGRLLYLKLGYSHDVELAVPPAVRVFCFKNNVI 55