BLASTX nr result
ID: Mentha29_contig00010452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010452 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22180.1| hypothetical protein MIMGU_mgv1a005078mg [Mimulus... 59 9e-07 >gb|EYU22180.1| hypothetical protein MIMGU_mgv1a005078mg [Mimulus guttatus] Length = 497 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 4/42 (9%) Frame = -3 Query: 351 QPQNSLLTRSTSWLNDVVS----SVSGYFGSTGKSNDDPYLN 238 QPQ LLTRSTSWL+DVVS SVSGY G GKSN D YLN Sbjct: 453 QPQTGLLTRSTSWLSDVVSNVSGSVSGYLGGAGKSNTDQYLN 494