BLASTX nr result
ID: Mentha29_contig00008438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00008438 (621 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858207.1| hypothetical protein AMTR_s00062p00178830 [A... 56 8e-06 >ref|XP_006858207.1| hypothetical protein AMTR_s00062p00178830 [Amborella trichopoda] gi|548862310|gb|ERN19674.1| hypothetical protein AMTR_s00062p00178830 [Amborella trichopoda] Length = 121 Score = 56.2 bits (134), Expect = 8e-06 Identities = 38/118 (32%), Positives = 61/118 (51%), Gaps = 15/118 (12%) Frame = -1 Query: 552 MGNCCRRESGAVWASLDEWKDE-----------IAPRKQPEEWVVAGE--GEDSGAPSPP 412 MGNC R+ S S + W+DE + P+ + EE V++ + G DS Sbjct: 1 MGNCVRKSS-----SWEGWEDEEWGCDEAEKLVLKPKVEREEEVLSKKKNGGDS------ 49 Query: 411 PLQLQDAVKIKISKRELERLIAAARVHDVPVDRLFSRFI--HGPRHRSWAPILLTIPE 244 VKI+ISK++LE L+ +H + VD++ + + +G +HR W P+L +IPE Sbjct: 50 -----KEVKIRISKKQLEELLGKMELHGMSVDQMIEQLMNTNGHKHRGWRPVLQSIPE 102