BLASTX nr result
ID: Mentha29_contig00007541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007541 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 70 3e-10 emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] 70 3e-10 ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicot... 70 3e-10 >ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis] gi|80750905|dbj|BAE47981.1| hypothetical protein [Nicotiana tomentosiformis] Length = 90 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 41 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKRITT 151 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKK ITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90 >emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] Length = 90 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 41 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKRITT 151 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKK ITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90 >ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453885|gb|AEO95543.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453996|gb|AEO95653.1| hypothetical protein [synthetic construct] Length = 90 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 41 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKRITT 151 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKK ITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90