BLASTX nr result
ID: Mentha29_contig00007213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007213 (678 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27465.1| hypothetical protein MIMGU_mgv1a005570mg [Mimulus... 69 1e-09 ref|XP_004244030.1| PREDICTED: coiled-coil domain-containing pro... 56 9e-06 >gb|EYU27465.1| hypothetical protein MIMGU_mgv1a005570mg [Mimulus guttatus] Length = 479 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 366 MEASSEILLNSLTNSDVPIPLGCTSVGDLTPPSLFSLCSAALRLIDG 226 MEAS EILL+SLTNS VPIP G TS+G TP +LFS+C+ ALRLIDG Sbjct: 1 MEASEEILLDSLTNSGVPIPAGFTSIGKFTPETLFSVCAHALRLIDG 47 >ref|XP_004244030.1| PREDICTED: coiled-coil domain-containing protein 22-like [Solanum lycopersicum] Length = 512 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -1 Query: 366 MEASSEILLNSLTNSDVPIPLGCTSVGDLTPPSLFSLCSAALRLIDGQ 223 ME S +ILLNS+ +S V IP G +SV DLTPP+LF++ S AL LID Q Sbjct: 1 MEESQDILLNSIASSGVTIPSGVSSVKDLTPPTLFAVSSQALYLIDRQ 48