BLASTX nr result
ID: Mentha29_contig00006861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006861 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28688.1| hypothetical protein MIMGU_mgv1a010386mg [Mimulus... 56 5e-06 gb|EYU22448.1| hypothetical protein MIMGU_mgv1a010522mg [Mimulus... 56 6e-06 >gb|EYU28688.1| hypothetical protein MIMGU_mgv1a010386mg [Mimulus guttatus] Length = 313 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 230 GKLRIKFDIKFPSRLSAEQKSDLRRVLGR 144 GKLRIKFD+KFPSRLS +QKSDLRRVLGR Sbjct: 282 GKLRIKFDVKFPSRLSTDQKSDLRRVLGR 310 >gb|EYU22448.1| hypothetical protein MIMGU_mgv1a010522mg [Mimulus guttatus] Length = 310 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 230 GKLRIKFDIKFPSRLSAEQKSDLRRVLGRA 141 G LRIKFD+KFPSRLSAEQKSDLRRVLG++ Sbjct: 280 GDLRIKFDVKFPSRLSAEQKSDLRRVLGKS 309