BLASTX nr result
ID: Mentha29_contig00006615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006615 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23079.3| unnamed protein product [Vitis vinifera] 59 1e-14 >emb|CBI23079.3| unnamed protein product [Vitis vinifera] Length = 86 Score = 59.3 bits (142), Expect(2) = 1e-14 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 23 MSFAIIRRDVEWEWEKSVWSFWYIYIIGSTCSLSEELLI 139 MSFA+I RDVE EWEKS WSF +++IGS CSLSE+L I Sbjct: 1 MSFAVIHRDVEREWEKSGWSFGSLFLIGSCCSLSEDLYI 39 Score = 46.2 bits (108), Expect(2) = 1e-14 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +3 Query: 192 ALEYLGAYEQRSLWSTAHLKDCSL 263 A+E+LGAYEQ SLWSTAHL+DCSL Sbjct: 58 AVEHLGAYEQWSLWSTAHLEDCSL 81