BLASTX nr result
ID: Mentha29_contig00006515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006515 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308001.1| PREDICTED: cyclic nucleotide-gated ion chann... 141 1e-31 ref|XP_007161376.1| hypothetical protein PHAVU_001G063700g [Phas... 140 1e-31 gb|AAN65366.1| cyclic nucleotide-gated channel C [Phaseolus vulg... 140 1e-31 ref|XP_007038984.1| Cyclic nucleotide gated channel 1 isoform 3 ... 140 2e-31 ref|XP_007038982.1| Cyclic nucleotide gated channel 1 isoform 1 ... 140 2e-31 gb|EYU25206.1| hypothetical protein MIMGU_mgv1a024404mg [Mimulus... 140 2e-31 ref|XP_003544128.1| PREDICTED: cyclic nucleotide-gated ion chann... 140 2e-31 gb|EXC69282.1| hypothetical protein L484_000176 [Morus notabilis] 138 7e-31 gb|EXB95022.1| Cyclic nucleotide-gated ion channel 1 [Morus nota... 138 7e-31 ref|XP_002317760.1| cyclic nucleotide-gated channel C family pro... 138 7e-31 ref|XP_006360173.1| PREDICTED: cyclic nucleotide-gated ion chann... 138 9e-31 ref|XP_002322017.2| cyclic nucleotide-gated channel C family pro... 137 1e-30 ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion chann... 137 2e-30 ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion chann... 137 2e-30 ref|XP_007220229.1| hypothetical protein PRUPE_ppa002135mg [Prun... 137 2e-30 ref|XP_003520870.1| PREDICTED: cyclic nucleotide-gated ion chann... 137 2e-30 ref|XP_004240953.1| PREDICTED: cyclic nucleotide-gated ion chann... 136 4e-30 ref|XP_007136556.1| hypothetical protein PHAVU_009G054700g [Phas... 135 5e-30 ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidop... 135 6e-30 ref|XP_006401742.1| hypothetical protein EUTSA_v10012801mg [Eutr... 135 6e-30 >ref|XP_004308001.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Fragaria vesca subsp. vesca] Length = 713 Score = 141 bits (355), Expect = 1e-31 Identities = 68/74 (91%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE Sbjct: 453 EENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 512 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 513 GDPVDEMLFIMRGK 526 >ref|XP_007161376.1| hypothetical protein PHAVU_001G063700g [Phaseolus vulgaris] gi|561034840|gb|ESW33370.1| hypothetical protein PHAVU_001G063700g [Phaseolus vulgaris] Length = 718 Score = 140 bits (354), Expect = 1e-31 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 ED L+RNLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVL+TE+SYIVRE Sbjct: 460 EDNLVRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLFTEESYIVRE 519 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 520 GDPVDEMLFIMRGK 533 >gb|AAN65366.1| cyclic nucleotide-gated channel C [Phaseolus vulgaris] Length = 566 Score = 140 bits (354), Expect = 1e-31 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 ED L+RNLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVL+TE+SYIVRE Sbjct: 308 EDNLVRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLFTEESYIVRE 367 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 368 GDPVDEMLFIMRGK 381 >ref|XP_007038984.1| Cyclic nucleotide gated channel 1 isoform 3 [Theobroma cacao] gi|508776229|gb|EOY23485.1| Cyclic nucleotide gated channel 1 isoform 3 [Theobroma cacao] Length = 505 Score = 140 bits (353), Expect = 2e-31 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+RNLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 247 EENLLRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLYTEESYIVRE 306 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 307 GDPVDEMLFIMRGK 320 >ref|XP_007038982.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|590673757|ref|XP_007038983.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|508776227|gb|EOY23483.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|508776228|gb|EOY23484.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] Length = 713 Score = 140 bits (353), Expect = 2e-31 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+RNLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 455 EENLLRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLYTEESYIVRE 514 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 515 GDPVDEMLFIMRGK 528 >gb|EYU25206.1| hypothetical protein MIMGU_mgv1a024404mg [Mimulus guttatus] Length = 715 Score = 140 bits (352), Expect = 2e-31 Identities = 66/74 (89%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI +LPKDLRRDIK+HLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTE+SYI+RE Sbjct: 455 EENLIHSLPKDLRRDIKRHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEESYILRE 514 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 515 GDPVDEMLFIMRGK 528 >ref|XP_003544128.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Length = 718 Score = 140 bits (352), Expect = 2e-31 Identities = 67/74 (90%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 ED LIRNLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCD LKPVLYTE+SYIVRE Sbjct: 460 EDNLIRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDLLKPVLYTEESYIVRE 519 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 520 GDPVDEMLFIMRGK 533 >gb|EXC69282.1| hypothetical protein L484_000176 [Morus notabilis] Length = 313 Score = 138 bits (348), Expect = 7e-31 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMDDQLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 55 EENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQLLDAMCDRLKPVLYTEESYIVRE 114 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRG+ Sbjct: 115 GDPVDEMLFIMRGR 128 >gb|EXB95022.1| Cyclic nucleotide-gated ion channel 1 [Morus notabilis] Length = 717 Score = 138 bits (348), Expect = 7e-31 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMDDQLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 459 EENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQLLDAMCDRLKPVLYTEESYIVRE 518 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRG+ Sbjct: 519 GDPVDEMLFIMRGR 532 >ref|XP_002317760.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] Length = 709 Score = 138 bits (348), Expect = 7e-31 Identities = 65/74 (87%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+ NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDA+CDRLKPVLYTE+SYIVRE Sbjct: 452 EEMLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLKPVLYTEESYIVRE 511 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLFVMRGK Sbjct: 512 GDPVDEMLFVMRGK 525 >ref|XP_006360173.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum tuberosum] Length = 708 Score = 138 bits (347), Expect = 9e-31 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDA+CDRLKPVLYTEDSYIVRE Sbjct: 450 EENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLKPVLYTEDSYIVRE 509 Query: 181 GDPVDEMLFVMRGK 222 GDPV+EMLFVMRGK Sbjct: 510 GDPVNEMLFVMRGK 523 >ref|XP_002322017.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] gi|550321788|gb|EEF06144.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] Length = 705 Score = 137 bits (346), Expect = 1e-30 Identities = 65/74 (87%), Positives = 70/74 (94%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+ NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKP LYTE+SYIVRE Sbjct: 448 EETLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPALYTEESYIVRE 507 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLFVMRGK Sbjct: 508 GDPVDEMLFVMRGK 521 >ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Length = 713 Score = 137 bits (345), Expect = 2e-30 Identities = 63/74 (85%), Positives = 72/74 (97%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+RNLPKDLRRDIK+HLCL+LL RVP+FEKMD+QLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 453 EENLVRNLPKDLRRDIKRHLCLSLLMRVPIFEKMDEQLLDAMCDRLKPVLYTEESYIVRE 512 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEM+F+MRGK Sbjct: 513 GDPVDEMIFIMRGK 526 >ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 137 bits (345), Expect = 2e-30 Identities = 65/74 (87%), Positives = 70/74 (94%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E L+ NLPKDLRRDIK+HLCLALL+RVPMFEKMD+QL+DAMCDRLKP LYTEDSYIVRE Sbjct: 451 EQNLLINLPKDLRRDIKRHLCLALLRRVPMFEKMDEQLMDAMCDRLKPALYTEDSYIVRE 510 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLFVMRGK Sbjct: 511 GDPVDEMLFVMRGK 524 >ref|XP_007220229.1| hypothetical protein PRUPE_ppa002135mg [Prunus persica] gi|462416691|gb|EMJ21428.1| hypothetical protein PRUPE_ppa002135mg [Prunus persica] Length = 711 Score = 137 bits (344), Expect = 2e-30 Identities = 65/74 (87%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVLYTE+SYIVRE Sbjct: 453 EENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLYTEESYIVRE 512 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRG+ Sbjct: 513 GDPVDEMLFIMRGR 526 >ref|XP_003520870.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Length = 728 Score = 137 bits (344), Expect = 2e-30 Identities = 65/74 (87%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LIRNLPKDLRRDIK+HLCLAL+K+VPMFEKMD+QLLDAMCDRLKPVLYTE SYIVRE Sbjct: 471 EEALIRNLPKDLRRDIKRHLCLALVKKVPMFEKMDEQLLDAMCDRLKPVLYTEKSYIVRE 530 Query: 181 GDPVDEMLFVMRGK 222 DPVDEMLF+MRGK Sbjct: 531 EDPVDEMLFIMRGK 544 >ref|XP_004240953.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum lycopersicum] Length = 708 Score = 136 bits (342), Expect = 4e-30 Identities = 65/74 (87%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ LI NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDA+CDRLKPVLYTE+SYIVRE Sbjct: 450 EENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLKPVLYTENSYIVRE 509 Query: 181 GDPVDEMLFVMRGK 222 GDPV+EMLFVMRGK Sbjct: 510 GDPVNEMLFVMRGK 523 >ref|XP_007136556.1| hypothetical protein PHAVU_009G054700g [Phaseolus vulgaris] gi|561009643|gb|ESW08550.1| hypothetical protein PHAVU_009G054700g [Phaseolus vulgaris] Length = 715 Score = 135 bits (341), Expect = 5e-30 Identities = 65/74 (87%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 ED LIR+LPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDAMCDRLKPVLYTE+S IVRE Sbjct: 457 EDNLIRDLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDAMCDRLKPVLYTEESCIVRE 516 Query: 181 GDPVDEMLFVMRGK 222 GDPVDE+LF+MRGK Sbjct: 517 GDPVDEILFIMRGK 530 >ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] gi|38502855|sp|O65717.1|CNGC1_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 1; Short=AtCNGC1; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 1 gi|13877753|gb|AAK43954.1|AF370139_1 putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|3096947|emb|CAA76178.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|9757994|dbj|BAB08416.1| cyclic nucleotide-regulated ion channel [Arabidopsis thaliana] gi|24030485|gb|AAN41391.1| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis thaliana] gi|332008928|gb|AED96311.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana] Length = 716 Score = 135 bits (340), Expect = 6e-30 Identities = 63/74 (85%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+ NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDA+CDRL+PVLYTE+SYIVRE Sbjct: 457 EENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLQPVLYTEESYIVRE 516 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 517 GDPVDEMLFIMRGK 530 >ref|XP_006401742.1| hypothetical protein EUTSA_v10012801mg [Eutrema salsugineum] gi|557102832|gb|ESQ43195.1| hypothetical protein EUTSA_v10012801mg [Eutrema salsugineum] Length = 719 Score = 135 bits (340), Expect = 6e-30 Identities = 63/74 (85%), Positives = 71/74 (95%) Frame = +1 Query: 1 EDYLIRNLPKDLRRDIKQHLCLALLKRVPMFEKMDDQLLDAMCDRLKPVLYTEDSYIVRE 180 E+ L+ NLPKDLRRDIK+HLCLALL RVPMFEKMD+QLLDA+CDRL+PVLYTE+SYIVRE Sbjct: 460 EENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLQPVLYTEESYIVRE 519 Query: 181 GDPVDEMLFVMRGK 222 GDPVDEMLF+MRGK Sbjct: 520 GDPVDEMLFIMRGK 533