BLASTX nr result
ID: Mentha29_contig00006261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006261 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta] 56 6e-06 >dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 511 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 281 DAPIDMTESPGLTNLKATPLQVYLVPRLRPEIYG 180 D P+DMTE+ GLTN KATPL+V + PRL PEIYG Sbjct: 477 DMPVDMTETAGLTNAKATPLEVVITPRLHPEIYG 510