BLASTX nr result
ID: Mentha29_contig00006260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006260 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40977.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinif... 56 5e-06 dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta] 56 6e-06 >emb|CBI40977.3| unnamed protein product [Vitis vinifera] Length = 543 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 TKASDAPIDMTESPGLTNLKATPLQVYLAPRLRPEIY 113 TK SD +DMTES GLTNLKATPL+V L+PRL+ E+Y Sbjct: 505 TKPSDGDVDMTESLGLTNLKATPLEVLLSPRLKAELY 541 >ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|147794787|emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera] Length = 528 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 TKASDAPIDMTESPGLTNLKATPLQVYLAPRLRPEIY 113 TK SD +DMTES GLTNLKATPL+V L+PRL+ E+Y Sbjct: 490 TKPSDGDVDMTESLGLTNLKATPLEVLLSPRLKAELY 526 >dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 511 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 15 DAPIDMTESPGLTNLKATPLQVYLAPRLRPEIYG 116 D P+DMTE+ GLTN KATPL+V + PRL PEIYG Sbjct: 477 DMPVDMTETAGLTNAKATPLEVVITPRLHPEIYG 510