BLASTX nr result
ID: Mentha29_contig00006135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006135 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40687.1| hypothetical protein MIMGU_mgv1a0062341mg, partia... 137 2e-30 gb|EYU40686.1| hypothetical protein MIMGU_mgv1a0062341mg, partia... 137 2e-30 ref|XP_006345890.1| PREDICTED: cysteine desulfurase 2, chloropla... 122 4e-26 ref|XP_004239746.1| PREDICTED: cysteine desulfurase 2, chloropla... 122 5e-26 ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloropla... 117 2e-24 gb|EPS69560.1| hypothetical protein M569_05202, partial [Genlise... 116 3e-24 ref|XP_007227484.1| hypothetical protein PRUPE_ppa005298mg [Prun... 115 5e-24 ref|XP_007015334.1| Chloroplastic NIFS-like cysteine desulfurase... 114 2e-23 ref|XP_007015333.1| Chloroplastic NIFS-like cysteine desulfurase... 114 2e-23 ref|XP_006586634.1| PREDICTED: uncharacterized protein LOC100500... 112 5e-23 ref|XP_003601651.1| Cysteine desulfurase [Medicago truncatula] g... 112 5e-23 gb|ACU15091.1| unknown [Glycine max] 112 5e-23 ref|XP_007147515.1| hypothetical protein PHAVU_006G131100g [Phas... 111 9e-23 ref|XP_004502227.1| PREDICTED: cysteine desulfurase 2, chloropla... 111 9e-23 ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloropla... 111 1e-22 ref|XP_003546241.1| PREDICTED: cysteine desulfurase 2, chloropla... 110 2e-22 ref|XP_002523229.1| cysteine desulfurylase, putative [Ricinus co... 110 2e-22 ref|XP_006470504.1| PREDICTED: cysteine desulfurase 2, chloropla... 106 3e-21 ref|XP_004308190.1| PREDICTED: cysteine desulfurase 2, chloropla... 104 1e-20 ref|XP_006446358.1| hypothetical protein CICLE_v10015188mg [Citr... 104 1e-20 >gb|EYU40687.1| hypothetical protein MIMGU_mgv1a0062341mg, partial [Mimulus guttatus] Length = 339 Score = 137 bits (344), Expect = 2e-30 Identities = 70/104 (67%), Positives = 76/104 (73%), Gaps = 3/104 (2%) Frame = +2 Query: 65 VLKLPPSLRLIRPNPXXXXXXXXXXXXXXXXXXXX---DPQLGPGSLGHLTRPDFPILHQ 235 VLKLPPS R+I+ +P D QLGPGSLG+LTRPDFPILHQ Sbjct: 8 VLKLPPSFRIIKQSPNCTNRTFRTVPFASATAPAPLSTDSQLGPGSLGYLTRPDFPILHQ 67 Query: 236 EVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 E+NGKRLVYLDNAATSQKP V+NALRNYYEAYNSNVHRGIHYL Sbjct: 68 ELNGKRLVYLDNAATSQKPEPVLNALRNYYEAYNSNVHRGIHYL 111 >gb|EYU40686.1| hypothetical protein MIMGU_mgv1a0062341mg, partial [Mimulus guttatus] Length = 336 Score = 137 bits (344), Expect = 2e-30 Identities = 70/104 (67%), Positives = 76/104 (73%), Gaps = 3/104 (2%) Frame = +2 Query: 65 VLKLPPSLRLIRPNPXXXXXXXXXXXXXXXXXXXX---DPQLGPGSLGHLTRPDFPILHQ 235 VLKLPPS R+I+ +P D QLGPGSLG+LTRPDFPILHQ Sbjct: 5 VLKLPPSFRIIKQSPNCTNRTFRTVPFASATAPAPLSTDSQLGPGSLGYLTRPDFPILHQ 64 Query: 236 EVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 E+NGKRLVYLDNAATSQKP V+NALRNYYEAYNSNVHRGIHYL Sbjct: 65 ELNGKRLVYLDNAATSQKPEPVLNALRNYYEAYNSNVHRGIHYL 108 >ref|XP_006345890.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Solanum tuberosum] Length = 476 Score = 122 bits (307), Expect = 4e-26 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 173 PQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHR 352 P+LGPGSLGH+TR DFPILHQE+NG +LVYLDNAATSQKP AV+ AL+NYYEAYNSNVHR Sbjct: 59 PKLGPGSLGHITRSDFPILHQEINGLKLVYLDNAATSQKPTAVIKALQNYYEAYNSNVHR 118 Query: 353 GIHYL 367 GIHYL Sbjct: 119 GIHYL 123 >ref|XP_004239746.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Solanum lycopersicum] Length = 477 Score = 122 bits (306), Expect = 5e-26 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 173 PQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHR 352 P+LGPGSLGH+TR DFPILHQE+NG +LVYLDNAATSQKP AV+ AL+NYYEAYNSNVHR Sbjct: 60 PKLGPGSLGHITRSDFPILHQEINGLKLVYLDNAATSQKPRAVIEALQNYYEAYNSNVHR 119 Query: 353 GIHYL 367 GIHYL Sbjct: 120 GIHYL 124 >ref|XP_002267920.1| PREDICTED: cysteine desulfurase 2, chloroplastic [Vitis vinifera] gi|296083920|emb|CBI24308.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 117 bits (292), Expect = 2e-24 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 D +G SLGHLTRPDFPILHQEVNG +LVYLDNAATSQKP AV+ AL+NYYEAYNSNVH Sbjct: 45 DSSIGSVSLGHLTRPDFPILHQEVNGSKLVYLDNAATSQKPTAVLKALQNYYEAYNSNVH 104 Query: 350 RGIHYL 367 RGIH+L Sbjct: 105 RGIHFL 110 >gb|EPS69560.1| hypothetical protein M569_05202, partial [Genlisea aurea] Length = 427 Score = 116 bits (291), Expect = 3e-24 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 D +LGPGSLGHLT DFPIL QE+NGKRLVYLDNAATSQKP +VVNAL++YYE+YN+NVH Sbjct: 12 DSKLGPGSLGHLTFGDFPILDQELNGKRLVYLDNAATSQKPVSVVNALKDYYESYNANVH 71 Query: 350 RGIHYL 367 RGIHYL Sbjct: 72 RGIHYL 77 >ref|XP_007227484.1| hypothetical protein PRUPE_ppa005298mg [Prunus persica] gi|462424420|gb|EMJ28683.1| hypothetical protein PRUPE_ppa005298mg [Prunus persica] Length = 468 Score = 115 bits (289), Expect = 5e-24 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGHLTRPDFPILHQEVNG RLVYLDNAATSQKP AV+ AL+NYYE+YNSNVHRGIHYL Sbjct: 57 SLGHLTRPDFPILHQEVNGSRLVYLDNAATSQKPTAVIGALQNYYESYNSNVHRGIHYL 115 >ref|XP_007015334.1| Chloroplastic NIFS-like cysteine desulfurase isoform 2 [Theobroma cacao] gi|508785697|gb|EOY32953.1| Chloroplastic NIFS-like cysteine desulfurase isoform 2 [Theobroma cacao] Length = 364 Score = 114 bits (284), Expect = 2e-23 Identities = 53/62 (85%), Positives = 56/62 (90%) Frame = +2 Query: 182 GPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIH 361 G SLGHL+RPDFPILHQEVNG +LVYLDNAATSQKP AV+ AL NYYEAYNSNVHRGIH Sbjct: 49 GSVSLGHLSRPDFPILHQEVNGSKLVYLDNAATSQKPTAVLKALHNYYEAYNSNVHRGIH 108 Query: 362 YL 367 YL Sbjct: 109 YL 110 >ref|XP_007015333.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] gi|508785696|gb|EOY32952.1| Chloroplastic NIFS-like cysteine desulfurase isoform 1 [Theobroma cacao] Length = 463 Score = 114 bits (284), Expect = 2e-23 Identities = 53/62 (85%), Positives = 56/62 (90%) Frame = +2 Query: 182 GPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIH 361 G SLGHL+RPDFPILHQEVNG +LVYLDNAATSQKP AV+ AL NYYEAYNSNVHRGIH Sbjct: 49 GSVSLGHLSRPDFPILHQEVNGSKLVYLDNAATSQKPTAVLKALHNYYEAYNSNVHRGIH 108 Query: 362 YL 367 YL Sbjct: 109 YL 110 >ref|XP_006586634.1| PREDICTED: uncharacterized protein LOC100500160 isoform X1 [Glycine max] gi|571475454|ref|XP_006586635.1| PREDICTED: uncharacterized protein LOC100500160 isoform X2 [Glycine max] Length = 468 Score = 112 bits (280), Expect = 5e-23 Identities = 51/66 (77%), Positives = 57/66 (86%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P +G SLGH TRP FPILHQEVNG +LVYLDNAATSQKP V+ AL+NYYEAYNSNVH Sbjct: 50 EPTVGSSSLGHSTRPHFPILHQEVNGSKLVYLDNAATSQKPTTVLKALQNYYEAYNSNVH 109 Query: 350 RGIHYL 367 RGIH+L Sbjct: 110 RGIHFL 115 >ref|XP_003601651.1| Cysteine desulfurase [Medicago truncatula] gi|355490699|gb|AES71902.1| Cysteine desulfurase [Medicago truncatula] Length = 327 Score = 112 bits (280), Expect = 5e-23 Identities = 52/66 (78%), Positives = 57/66 (86%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P L SLGH TRP FPILHQEVNG +LVY+DNAATSQKPAAVV AL++YYE YNSNVH Sbjct: 48 EPTLSSPSLGHTTRPHFPILHQEVNGSKLVYIDNAATSQKPAAVVKALQDYYEGYNSNVH 107 Query: 350 RGIHYL 367 RGIHYL Sbjct: 108 RGIHYL 113 >gb|ACU15091.1| unknown [Glycine max] Length = 205 Score = 112 bits (280), Expect = 5e-23 Identities = 51/66 (77%), Positives = 57/66 (86%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P +G SLGH TRP FPILHQEVNG +LVYLDNAATSQKP V+ AL+NYYEAYNSNVH Sbjct: 50 EPTVGSSSLGHSTRPHFPILHQEVNGSKLVYLDNAATSQKPTTVLKALQNYYEAYNSNVH 109 Query: 350 RGIHYL 367 RGIH+L Sbjct: 110 RGIHFL 115 >ref|XP_007147515.1| hypothetical protein PHAVU_006G131100g [Phaseolus vulgaris] gi|561020738|gb|ESW19509.1| hypothetical protein PHAVU_006G131100g [Phaseolus vulgaris] Length = 471 Score = 111 bits (278), Expect = 9e-23 Identities = 51/66 (77%), Positives = 57/66 (86%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P +G SLGH TRP FPILHQEVNG +LVYLDNAATSQKP AV+ AL+NYYE YNSNVH Sbjct: 53 EPAVGSPSLGHSTRPHFPILHQEVNGSKLVYLDNAATSQKPTAVLKALQNYYEGYNSNVH 112 Query: 350 RGIHYL 367 RGIH+L Sbjct: 113 RGIHFL 118 >ref|XP_004502227.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cicer arietinum] Length = 471 Score = 111 bits (278), Expect = 9e-23 Identities = 50/66 (75%), Positives = 57/66 (86%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P LG SLGH TRP FPILHQEVNG +LVY+DNAATSQKP AVV AL+NYYE YN+NVH Sbjct: 53 EPTLGSSSLGHSTRPHFPILHQEVNGSKLVYIDNAATSQKPTAVVKALQNYYEGYNANVH 112 Query: 350 RGIHYL 367 RG+H+L Sbjct: 113 RGMHFL 118 >ref|XP_004140178.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] gi|449481029|ref|XP_004156061.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Cucumis sativus] Length = 485 Score = 111 bits (277), Expect = 1e-22 Identities = 50/59 (84%), Positives = 56/59 (94%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGH TRPDFPILHQEVNG +LVYLDNAATSQKP +V+NAL+NYY+AYNSNVHRGIH+L Sbjct: 74 SLGHTTRPDFPILHQEVNGSKLVYLDNAATSQKPISVLNALQNYYQAYNSNVHRGIHFL 132 >ref|XP_003546241.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like isoform X1 [Glycine max] gi|571518160|ref|XP_006597653.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like isoform X2 [Glycine max] Length = 468 Score = 110 bits (275), Expect = 2e-22 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = +2 Query: 170 DPQLGPGSLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVH 349 +P +G SLGH TRP FPILHQEVNG +LVYLDNAATSQKP AV+ AL+NYYEAYNSNVH Sbjct: 50 EPIVGFLSLGHSTRPHFPILHQEVNGSKLVYLDNAATSQKPTAVLKALQNYYEAYNSNVH 109 Query: 350 RGIHYL 367 RGIH+L Sbjct: 110 RGIHFL 115 >ref|XP_002523229.1| cysteine desulfurylase, putative [Ricinus communis] gi|223537525|gb|EEF39150.1| cysteine desulfurylase, putative [Ricinus communis] Length = 469 Score = 110 bits (275), Expect = 2e-22 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGH+TRPDFPILHQEVNG +LVYLDNAATSQKP +V+ A++NYYE+YNSNVHRGIHYL Sbjct: 58 SLGHITRPDFPILHQEVNGSKLVYLDNAATSQKPNSVLKAIQNYYESYNSNVHRGIHYL 116 >ref|XP_006470504.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Citrus sinensis] Length = 458 Score = 106 bits (265), Expect = 3e-21 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 1/60 (1%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNG-KRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGH+TRPDFPILHQEV G K+LVYLDNAATSQKP AV+ AL+NYYEAYNSNVHRGIH+L Sbjct: 46 SLGHITRPDFPILHQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFL 105 >ref|XP_004308190.1| PREDICTED: cysteine desulfurase 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 398 Score = 104 bits (260), Expect = 1e-20 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNGKRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGHLTRPDFPILHQEV G RLVYLDNAATSQKP V+ AL+ YY+ YNSNVHRGIH+L Sbjct: 43 SLGHLTRPDFPILHQEVYGSRLVYLDNAATSQKPITVLKALQEYYQGYNSNVHRGIHFL 101 >ref|XP_006446358.1| hypothetical protein CICLE_v10015188mg [Citrus clementina] gi|557548969|gb|ESR59598.1| hypothetical protein CICLE_v10015188mg [Citrus clementina] Length = 458 Score = 104 bits (259), Expect = 1e-20 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 1/60 (1%) Frame = +2 Query: 191 SLGHLTRPDFPILHQEVNG-KRLVYLDNAATSQKPAAVVNALRNYYEAYNSNVHRGIHYL 367 SLGH+TRPDFPIL+QEV G K+LVYLDNAATSQKP AV+ AL+NYYEAYNSNVHRGIH+L Sbjct: 46 SLGHITRPDFPILYQEVYGSKKLVYLDNAATSQKPIAVLKALQNYYEAYNSNVHRGIHFL 105