BLASTX nr result
ID: Mentha29_contig00005989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00005989 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353985.1| PREDICTED: serine/arginine-rich splicing fac... 174 9e-42 ref|XP_004237903.1| PREDICTED: uncharacterized protein LOC101251... 174 9e-42 ref|XP_004237902.1| PREDICTED: uncharacterized protein LOC101251... 174 9e-42 ref|NP_001274830.1| serine/arginine-rich splicing factor 2-like ... 174 9e-42 ref|XP_007223283.1| hypothetical protein PRUPE_ppa009468mg [Prun... 174 1e-41 ref|XP_004300636.1| PREDICTED: uncharacterized protein LOC101307... 172 3e-41 gb|EXC06736.1| Serine/arginine-rich splicing factor 2 [Morus not... 171 1e-40 ref|XP_002302293.2| hypothetical protein POPTR_0002s09630g [Popu... 171 1e-40 ref|XP_002285794.1| PREDICTED: uncharacterized protein LOC100243... 171 1e-40 ref|XP_002531488.1| serine/arginine rich splicing factor, putati... 170 2e-40 ref|XP_006383495.1| hypothetical protein POPTR_0005s17020g [Popu... 169 3e-40 ref|XP_006383494.1| hypothetical protein POPTR_0005s17020g [Popu... 169 3e-40 gb|ABK94120.1| unknown [Populus trichocarpa] 169 3e-40 ref|XP_006487650.1| PREDICTED: serine/arginine-rich splicing fac... 169 5e-40 ref|XP_006472615.1| PREDICTED: serine/arginine-rich splicing fac... 169 5e-40 ref|XP_006433997.1| hypothetical protein CICLE_v10002266mg [Citr... 169 5e-40 ref|XP_006423893.1| hypothetical protein CICLE_v10029102mg [Citr... 169 5e-40 ref|XP_006849807.1| hypothetical protein AMTR_s00176p00054790 [A... 169 5e-40 ref|XP_007042969.1| Serine/arginine rich splicing factor, putati... 169 5e-40 ref|XP_007042967.1| Serine/arginine rich splicing factor, putati... 169 5e-40 >ref|XP_006353985.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X2 [Solanum tuberosum] Length = 257 Score = 174 bits (442), Expect = 9e-42 Identities = 83/86 (96%), Positives = 86/86 (100%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI+DT+SLLVLN+TFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIKDTYSLLVLNVTFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEAQKAVEKLDGRVVDGRE Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGRE 86 >ref|XP_004237903.1| PREDICTED: uncharacterized protein LOC101251771 isoform 2 [Solanum lycopersicum] Length = 258 Score = 174 bits (442), Expect = 9e-42 Identities = 83/86 (96%), Positives = 86/86 (100%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI+DT+SLLVLN+TFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIKDTYSLLVLNVTFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEAQKAVEKLDGRVVDGRE Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGRE 86 >ref|XP_004237902.1| PREDICTED: uncharacterized protein LOC101251771 isoform 1 [Solanum lycopersicum] Length = 269 Score = 174 bits (442), Expect = 9e-42 Identities = 83/86 (96%), Positives = 86/86 (100%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI+DT+SLLVLN+TFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIKDTYSLLVLNVTFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEAQKAVEKLDGRVVDGRE Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGRE 86 >ref|NP_001274830.1| serine/arginine-rich splicing factor 2-like [Solanum tuberosum] gi|78191396|gb|ABB29919.1| unknown [Solanum tuberosum] Length = 258 Score = 174 bits (442), Expect = 9e-42 Identities = 83/86 (96%), Positives = 86/86 (100%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI+DT+SLLVLN+TFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIKDTYSLLVLNVTFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEAQKAVEKLDGRVVDGRE Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGRE 86 >ref|XP_007223283.1| hypothetical protein PRUPE_ppa009468mg [Prunus persica] gi|462420219|gb|EMJ24482.1| hypothetical protein PRUPE_ppa009468mg [Prunus persica] Length = 291 Score = 174 bits (441), Expect = 1e-41 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDT+SLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEA KAVEKLDGRVVDGRE Sbjct: 61 FVRYKYQDEASKAVEKLDGRVVDGRE 86 >ref|XP_004300636.1| PREDICTED: uncharacterized protein LOC101307796 [Fragaria vesca subsp. vesca] Length = 253 Score = 172 bits (437), Expect = 3e-41 Identities = 83/86 (96%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDT+SLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKYQDEA KAV+KLDGRVVDGRE Sbjct: 61 FVRYKYQDEAAKAVDKLDGRVVDGRE 86 >gb|EXC06736.1| Serine/arginine-rich splicing factor 2 [Morus notabilis] Length = 295 Score = 171 bits (433), Expect = 1e-40 Identities = 82/86 (95%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDT+SLLVLNITFRTTADDLFPLFD+YGKVVDVFIPRDRRTG+SRGFA Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDLFPLFDRYGKVVDVFIPRDRRTGESRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAVEKLDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVEKLDGRVVDGRE 86 >ref|XP_002302293.2| hypothetical protein POPTR_0002s09630g [Populus trichocarpa] gi|550344654|gb|EEE81566.2| hypothetical protein POPTR_0002s09630g [Populus trichocarpa] Length = 235 Score = 171 bits (433), Expect = 1e-40 Identities = 82/86 (95%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTG+SRGFA Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVDRLDGRVVDGRE 86 >ref|XP_002285794.1| PREDICTED: uncharacterized protein LOC100243776 [Vitis vinifera] gi|302141951|emb|CBI19154.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 171 bits (433), Expect = 1e-40 Identities = 83/86 (96%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDT+SLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAVEKLDGR VDGRE Sbjct: 61 FVRYKYADEAQKAVEKLDGRNVDGRE 86 >ref|XP_002531488.1| serine/arginine rich splicing factor, putative [Ricinus communis] gi|223528897|gb|EEF30895.1| serine/arginine rich splicing factor, putative [Ricinus communis] Length = 257 Score = 170 bits (430), Expect = 2e-40 Identities = 81/86 (94%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI DT+SLLVLNITFRTTADDLFPLFDKYGKVVD+FIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAVE+LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVERLDGRVVDGRE 86 >ref|XP_006383495.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|566171807|ref|XP_002306575.2| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339146|gb|ERP61292.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339147|gb|EEE93571.2| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] Length = 270 Score = 169 bits (429), Expect = 3e-40 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTG+SRGFA Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY +EAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYAEEAQKAVDRLDGRVVDGRE 86 >ref|XP_006383494.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339145|gb|ERP61291.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] Length = 238 Score = 169 bits (429), Expect = 3e-40 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTG+SRGFA Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY +EAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYAEEAQKAVDRLDGRVVDGRE 86 >gb|ABK94120.1| unknown [Populus trichocarpa] Length = 302 Score = 169 bits (429), Expect = 3e-40 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTG+SRGFA Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY +EAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYAEEAQKAVDRLDGRVVDGRE 86 >ref|XP_006487650.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X1 [Citrus sinensis] gi|568868810|ref|XP_006487651.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X2 [Citrus sinensis] gi|568868812|ref|XP_006487652.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform X3 [Citrus sinensis] Length = 257 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI DT+SLLVLNITFRTTADDLFPLFDKYGKVVD+FIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVDRLDGRVVDGRE 86 >ref|XP_006472615.1| PREDICTED: serine/arginine-rich splicing factor 2-like [Citrus sinensis] Length = 251 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDLFPLF+KYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVDRLDGRVVDGRE 86 >ref|XP_006433997.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|567882879|ref|XP_006433998.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|557536119|gb|ESR47237.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|557536120|gb|ESR47238.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] Length = 251 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 85/86 (98%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDLFPLF+KYGKVVDVFIPRDRRTGDSRGFA Sbjct: 1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVDRLDGRVVDGRE 86 >ref|XP_006423893.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] gi|567862480|ref|XP_006423894.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] gi|567862482|ref|XP_006423895.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] gi|557525827|gb|ESR37133.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] gi|557525828|gb|ESR37134.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] gi|557525829|gb|ESR37135.1| hypothetical protein CICLE_v10029102mg [Citrus clementina] Length = 257 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI DT+SLLVLNITFRTTADDLFPLFDKYGKVVD+FIPRDRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPRDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAV++LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVDRLDGRVVDGRE 86 >ref|XP_006849807.1| hypothetical protein AMTR_s00176p00054790 [Amborella trichopoda] gi|548853384|gb|ERN11388.1| hypothetical protein AMTR_s00176p00054790 [Amborella trichopoda] Length = 258 Score = 169 bits (427), Expect = 5e-40 Identities = 81/86 (94%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI+DTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRD+RTGDSRGFA Sbjct: 1 MSHFGRSGPPDIKDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDKRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQ+AVEKLDGR VDGRE Sbjct: 61 FVRYKYADEAQRAVEKLDGRNVDGRE 86 >ref|XP_007042969.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] gi|590688515|ref|XP_007042971.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] gi|508706904|gb|EOX98800.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] gi|508706906|gb|EOX98802.1| Serine/arginine rich splicing factor, putative isoform 3 [Theobroma cacao] Length = 257 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI DT+SLLVLNITFRTTADDLFPLFDKYGKVVD+FIP+DRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPKDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAVE+LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVERLDGRVVDGRE 86 >ref|XP_007042967.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] gi|590688506|ref|XP_007042968.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] gi|590688512|ref|XP_007042970.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] gi|508706902|gb|EOX98798.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] gi|508706903|gb|EOX98799.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] gi|508706905|gb|EOX98801.1| Serine/arginine rich splicing factor, putative isoform 1 [Theobroma cacao] Length = 268 Score = 169 bits (427), Expect = 5e-40 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = +3 Query: 69 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFA 248 MSHFGRSGPPDI DT+SLLVLNITFRTTADDLFPLFDKYGKVVD+FIP+DRRTGDSRGFA Sbjct: 1 MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPKDRRTGDSRGFA 60 Query: 249 FVRYKYQDEAQKAVEKLDGRVVDGRE 326 FVRYKY DEAQKAVE+LDGRVVDGRE Sbjct: 61 FVRYKYADEAQKAVERLDGRVVDGRE 86