BLASTX nr result
ID: Mentha29_contig00004629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00004629 (1185 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 65 6e-08 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 65.1 bits (157), Expect = 6e-08 Identities = 64/254 (25%), Positives = 107/254 (42%), Gaps = 12/254 (4%) Frame = -1 Query: 933 SYLSVYSVPEFSLIQSHILPIYKR---GKFVGSHCKGLYFYTDLMHNFVLIDLTTKVFKP 763 S LS FS+ ++ LP ++ V C GL D L + +T+ FK Sbjct: 78 SALSTEKGENFSVTENIHLPFFENCWYAPVVSGPCNGLLCLHDA-GKAALWNPSTREFK- 135 Query: 762 LSLPKLKPTRIPEVHTC-----GIGLDPVSDVYEIL--VVYHFSKIGIDGHKVYQGFKNR 604 LP+ R P V + G G D ++D Y+++ V +F + +G + ++ Sbjct: 136 -ILPRSSVNRPPSVDSTSFGCLGFGFDSITDDYKVVRFVTNYFDENEEEGGLA--DWIHQ 192 Query: 603 AHLYSLGTDSWTEVPCPDT--FTSNFDSVYIGHERYWTALIDGPNPVPVDGVYFVEDEVV 430 LYSL +DSW E+ P+ + S + Y+ YW A + + ++ Sbjct: 193 VELYSLKSDSWKEISVPEAHPYASPLFNNYVNGSYYWQATGNS------------DYLIL 240 Query: 429 SFNFRSKKFKVFPLPAYPIKNYKYKYNLIEYDGMLGAIGYLKNEGPTEYVIWEYKERSWH 250 SF+ ++KF PLP + +Y L++++G LGAI Y + +W Sbjct: 241 SFDMANEKFSTLPLPTFGGSLAQYYLQLLDFNGSLGAIVYPREGTEKSIDLWVMNGSWTR 300 Query: 249 QVRTFSFGCVEKAL 208 Q S VE+ L Sbjct: 301 QFSIESVSGVERPL 314