BLASTX nr result
ID: Mentha29_contig00004582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00004582 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26012.1| hypothetical protein MIMGU_mgv1a013198mg [Mimulus... 59 9e-07 >gb|EYU26012.1| hypothetical protein MIMGU_mgv1a013198mg [Mimulus guttatus] Length = 228 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/86 (43%), Positives = 44/86 (51%), Gaps = 3/86 (3%) Frame = -2 Query: 251 MPTILLRIFLVYKVFNTFFQYLVPKKLRAYFPTS--SYAXXXXXXXXQLHIKKEDL-XXX 81 MPTILLRIFL+YK+ NT F YLVPKKLR + P S Y Q H + Sbjct: 1 MPTILLRIFLLYKLLNTIFLYLVPKKLRTFLPPSWYPYLHQQEQQKQQKHNNTNTINEPA 60 Query: 80 XXXXXXXXXXXVRLPQRMDIEELRRV 3 + P+RMD +ELRRV Sbjct: 61 SPSSSPVISPLHKFPRRMDADELRRV 86