BLASTX nr result
ID: Mentha29_contig00004581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00004581 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26012.1| hypothetical protein MIMGU_mgv1a013198mg [Mimulus... 57 3e-06 >gb|EYU26012.1| hypothetical protein MIMGU_mgv1a013198mg [Mimulus guttatus] Length = 228 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/86 (41%), Positives = 41/86 (47%), Gaps = 1/86 (1%) Frame = -3 Query: 257 MPTILLRIFLVYKVFNTFFQYLVPKKLRAYFPTFSYAXXXXXXXXXXQLHIKKEDF-XXX 81 MPTILLRIFL+YK+ NT F YLVPKKLR + P Y Q H Sbjct: 1 MPTILLRIFLLYKLLNTIFLYLVPKKLRTFLPPSWYPYLHQQEQQKQQKHNNTNTINEPA 60 Query: 80 XXXXXXXXXXXVCLPQRMDLEELRRV 3 P+RMD +ELRRV Sbjct: 61 SPSSSPVISPLHKFPRRMDADELRRV 86