BLASTX nr result
ID: Mentha29_contig00004549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00004549 (490 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18470.1| hypothetical protein MIMGU_mgv1a010476mg [Mimulus... 71 2e-10 >gb|EYU18470.1| hypothetical protein MIMGU_mgv1a010476mg [Mimulus guttatus] Length = 311 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = +1 Query: 1 ALSADKETTGAMTIAFINAIKDSVRRNHNITYHDIMDSMHNQIKEAGQSGGFFAGIRRIF 180 A S +KE TGAMT FI AIK + ITY ++DSMH +++A +SG G+RR+F Sbjct: 228 AFSQEKEMTGAMTSTFIGAIKAAAGNKEKITYSGVLDSMHQSLRQAHKSGCISTGLRRVF 287 Query: 181 HRRILQ 198 HR+ILQ Sbjct: 288 HRKILQ 293