BLASTX nr result
ID: Mentha29_contig00003257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003257 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36672.1| hypothetical protein MIMGU_mgv1a016329mg [Mimulus... 65 1e-08 >gb|EYU36672.1| hypothetical protein MIMGU_mgv1a016329mg [Mimulus guttatus] Length = 125 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = -1 Query: 205 TFTRKTSNFTPPEFHKSYACTTADSYQKTFVQRRSIALGLAGVVWGLSTGGGNAWGAARR 26 TF+RKT N P F K +A ++ + ++T +QRRSIALGLA VV GLS GGGNA AARR Sbjct: 18 TFSRKTPNLASPRFLKVWA--SSSNQEETHIQRRSIALGLASVVLGLSIGGGNAKAAARR 75