BLASTX nr result
ID: Mentha29_contig00003256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003256 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36672.1| hypothetical protein MIMGU_mgv1a016329mg [Mimulus... 62 1e-07 >gb|EYU36672.1| hypothetical protein MIMGU_mgv1a016329mg [Mimulus guttatus] Length = 125 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -1 Query: 205 TFTRKTSSFTPPEFHKSYACTTADSDHKTLVQRRSIALGLAGVVWGLSTGGGNAWGAARR 26 TF+RKT + P F K +A ++ + +T +QRRSIALGLA VV GLS GGGNA AARR Sbjct: 18 TFSRKTPNLASPRFLKVWA--SSSNQEETHIQRRSIALGLASVVLGLSIGGGNAKAAARR 75