BLASTX nr result
ID: Mentha29_contig00003107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003107 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18575.1| hypothetical protein MIMGU_mgv1a013310mg [Mimulus... 72 8e-11 gb|EPS59072.1| hypothetical protein M569_15738, partial [Genlise... 55 1e-05 >gb|EYU18575.1| hypothetical protein MIMGU_mgv1a013310mg [Mimulus guttatus] Length = 224 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/45 (77%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -2 Query: 221 FFIDGSATSLAAQPYMV-ADGGPSAAGVDFDSFCSFPTLESWKVM 90 FF+DGSA+SLAAQP A GG SA+G+DFDSFCSFPTLESWKVM Sbjct: 180 FFLDGSASSLAAQPLTATAYGGGSASGIDFDSFCSFPTLESWKVM 224 >gb|EPS59072.1| hypothetical protein M569_15738, partial [Genlisea aurea] Length = 137 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -2 Query: 221 FFIDGSATSLAAQPYMVADGGPSAAGVDFDSFCSFPTLESWKVM 90 FF DG+A +AA ADGG A +DFDSFCSFPTLESWKVM Sbjct: 97 FFCDGAAAVMAATG--TADGGAGTA-LDFDSFCSFPTLESWKVM 137