BLASTX nr result
ID: Mentha29_contig00003106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003106 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18575.1| hypothetical protein MIMGU_mgv1a013310mg [Mimulus... 70 4e-10 gb|EPS59072.1| hypothetical protein M569_15738, partial [Genlise... 57 3e-06 >gb|EYU18575.1| hypothetical protein MIMGU_mgv1a013310mg [Mimulus guttatus] Length = 224 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/45 (75%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 417 FFIDGSAASLAAAPYMV-ADGGPSAAGVDFDSFCSFPTLESWKVM 286 FF+DGSA+SLAA P A GG SA+G+DFDSFCSFPTLESWKVM Sbjct: 180 FFLDGSASSLAAQPLTATAYGGGSASGIDFDSFCSFPTLESWKVM 224 >gb|EPS59072.1| hypothetical protein M569_15738, partial [Genlisea aurea] Length = 137 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -2 Query: 417 FFIDGSAASLAAAPYMVADGGPSAAGVDFDSFCSFPTLESWKVM 286 FF DG+AA +AA ADGG A +DFDSFCSFPTLESWKVM Sbjct: 97 FFCDGAAAVMAATG--TADGGAGTA-LDFDSFCSFPTLESWKVM 137