BLASTX nr result
ID: Mentha29_contig00002365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00002365 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42818.1| hypothetical protein MIMGU_mgv1a009983mg [Mimulus... 56 4e-06 >gb|EYU42818.1| hypothetical protein MIMGU_mgv1a009983mg [Mimulus guttatus] Length = 325 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = -1 Query: 247 DAGDAHGSNRDLEIQNEQKDNKHAFP-DQEVRSILAATREDPVVSKEGAFHRAYPARNNV 71 +A SN + +IQNE D+EV S+ E P VSKE + H YPA NN Sbjct: 204 EAAKGDVSNENEQIQNEPNSTSGQITTDEEVGSLSVEASEMPAVSKEVSSHGDYPALNNS 263 Query: 70 VANKDVELPQEEKITSPPPTSN 5 + N +E P+E+K PPT+N Sbjct: 264 MMNTSLEQPREKKEVQAPPTAN 285