BLASTX nr result
ID: Mentha29_contig00002006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00002006 (911 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18630.1| hypothetical protein MIMGU_mgv1a015164mg [Mimulus... 60 1e-06 >gb|EYU18630.1| hypothetical protein MIMGU_mgv1a015164mg [Mimulus guttatus] Length = 166 Score = 60.1 bits (144), Expect = 1e-06 Identities = 41/94 (43%), Positives = 52/94 (55%), Gaps = 12/94 (12%) Frame = -3 Query: 660 VVYITNPIKFTTSASEFRALVQELTGQDAGTPYSA---------AVFLPEDGGGEGVKAA 508 VVYITNPIK +ASEFRALVQELTGQDA +A V V A Sbjct: 38 VVYITNPIKINATASEFRALVQELTGQDADFSETARFAAAGAADKVEAVAPAAAAKVAAV 97 Query: 507 EERNAHAALDESE-IGHFSSEVAEKEKP--DPIS 415 +E +AHA ++ E +G +S+ E+ P DP+S Sbjct: 98 KEESAHAVVEGVEKLGQTNSDDVERNGPGSDPLS 131