BLASTX nr result
ID: Mentha29_contig00001569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00001569 (839 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18977.1| hypothetical protein MIMGU_mgv1a016754mg [Mimulus... 59 2e-06 >gb|EYU18977.1| hypothetical protein MIMGU_mgv1a016754mg [Mimulus guttatus] Length = 108 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +2 Query: 200 NMFFSPI-VTPQRRVLRXXXXXXXXXXXXXXXXXILDFILGSLTKQDQFYETDPILKKVE 376 N+F +PI VTPQRRVLR +LDFILG L K++Q YET+PILKKVE Sbjct: 5 NLFVAPINVTPQRRVLRTAATAAKSSGGGGEEKGLLDFILGGLAKEEQIYETNPILKKVE 64