BLASTX nr result
ID: Mentha29_contig00000762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00000762 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus... 62 6e-08 >gb|EYU45312.1| hypothetical protein MIMGU_mgv1a020920mg [Mimulus guttatus] Length = 91 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = +2 Query: 218 AAAVKIDDLKKAKGEAVKT---PSKAAKDRQTTRSPRFAVELDGVHCFETLVPY 370 AAAVKIDDLKK GE V + P K ++RQ R+PRFA E DG++CFET++PY Sbjct: 40 AAAVKIDDLKK--GEEVNSSSPPPKKPENRQMIRAPRFAPEFDGIYCFETIIPY 91