BLASTX nr result
ID: Mentha28_contig00032239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00032239 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18598.1| hypothetical protein MIMGU_mgv1a024346mg [Mimulus... 58 1e-06 >gb|EYU18598.1| hypothetical protein MIMGU_mgv1a024346mg [Mimulus guttatus] Length = 1020 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 2 LKAGIRLVEPSNVQMYENLSTKFQRLVHSTAKEDDSDSE-PCPIKPSHVTLW 154 LK GI+ V PS+V Y+ L+ KFQRLVHSTAKED +E I+PSH +LW Sbjct: 969 LKVGIKQVNPSDVGTYDELTEKFQRLVHSTAKEDHLAAETSLSIQPSHKSLW 1020