BLASTX nr result
ID: Mentha28_contig00030108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00030108 (718 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46798.1| hypothetical protein MIMGU_mgv1a000275mg [Mimulus... 93 1e-16 ref|XP_006349254.1| PREDICTED: BRCT domain-containing protein At... 80 5e-13 ref|XP_006355860.1| PREDICTED: BRCT domain-containing protein At... 80 9e-13 ref|XP_004240652.1| PREDICTED: uncharacterized protein LOC101248... 79 1e-12 ref|XP_002270203.2| PREDICTED: BRCT domain-containing protein At... 79 1e-12 emb|CAN62071.1| hypothetical protein VITISV_036193 [Vitis vinifera] 79 1e-12 ref|XP_002320980.2| BRCT domain-containing family protein, parti... 78 3e-12 ref|XP_007051075.1| Transcription coactivators, putative [Theobr... 77 8e-12 ref|XP_002301504.2| BRCT domain-containing family protein [Popul... 76 1e-11 ref|XP_006492315.1| PREDICTED: BRCT domain-containing protein At... 75 3e-11 ref|XP_006492314.1| PREDICTED: BRCT domain-containing protein At... 75 3e-11 ref|XP_006444467.1| hypothetical protein CICLE_v100245902mg, par... 75 3e-11 gb|EPS63240.1| hypothetical protein M569_11549 [Genlisea aurea] 74 4e-11 ref|XP_002515302.1| DNA replication regulator dpb11, putative [R... 74 4e-11 ref|XP_007199477.1| hypothetical protein PRUPE_ppa027200mg [Prun... 72 2e-10 ref|XP_004301808.1| PREDICTED: uncharacterized protein LOC101306... 71 3e-10 gb|EXB59333.1| BRCT domain-containing protein [Morus notabilis] 67 5e-09 ref|XP_004136156.1| PREDICTED: uncharacterized protein LOC101219... 67 6e-09 gb|EPS68251.1| hypothetical protein M569_06518, partial [Genlise... 66 1e-08 gb|EYU36563.1| hypothetical protein MIMGU_mgv1a002804mg [Mimulus... 64 4e-08 >gb|EYU46798.1| hypothetical protein MIMGU_mgv1a000275mg [Mimulus guttatus] Length = 1316 Score = 92.8 bits (229), Expect = 1e-16 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = +1 Query: 529 MLESEQISAYDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVD 708 MLES+Q S YDDPS F G+RF+L GFD +E+++R+ LLEGGGVD VNYGP C H IVD Sbjct: 1 MLESKQNSEYDDPSKTFHGVRFILLGFDSDKEDEIRAKLLEGGGVDAVNYGPGCNHVIVD 60 Query: 709 KIV 717 K+V Sbjct: 61 KLV 63 >ref|XP_006349254.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Solanum tuberosum] Length = 1214 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = +1 Query: 529 MLESEQISAYDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVD 708 M ESEQ YD PS F+G+RFVL GFD ++E+VRS LLE GGVDV YGP+CTH IVD Sbjct: 1 MAESEQDMLYD-PSKIFIGVRFVLAGFDSPKKEQVRSKLLEAGGVDVNEYGPDCTHLIVD 59 Query: 709 KIV 717 + V Sbjct: 60 RTV 62 >ref|XP_006355860.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Solanum tuberosum] Length = 1428 Score = 79.7 bits (195), Expect = 9e-13 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +1 Query: 556 YDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 Y+D S FV +RFVL GFDP+R+E++RS L+EGGGVD YGP+CTH IVD I+ Sbjct: 7 YEDSSKIFVDVRFVLIGFDPLRKEQIRSKLVEGGGVDAGKYGPDCTHLIVDSII 60 >ref|XP_004240652.1| PREDICTED: uncharacterized protein LOC101248303 [Solanum lycopersicum] Length = 1174 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +1 Query: 556 YDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 Y+D S FVG+RFVL GFDP R+E+++S L+EGGGVD YGP+CTH IVD I+ Sbjct: 3 YEDSSKIFVGVRFVLIGFDPHRKEQIQSKLVEGGGVDAGKYGPDCTHLIVDSII 56 >ref|XP_002270203.2| PREDICTED: BRCT domain-containing protein At4g02110-like [Vitis vinifera] Length = 1314 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +1 Query: 556 YDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 +++ NAF+G+ FVLFGFDPV E +VRS L+ GGGVDV YG NCTH +VDK+V Sbjct: 4 FENSFNAFLGVHFVLFGFDPVHEREVRSKLVNGGGVDVGRYGQNCTHVVVDKLV 57 >emb|CAN62071.1| hypothetical protein VITISV_036193 [Vitis vinifera] Length = 1391 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +1 Query: 556 YDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 +++ NAF+G+ FVLFGFDPV E +VRS L+ GGGVDV YG NCTH +VDK+V Sbjct: 4 FENSFNAFLGVHFVLFGFDPVHEREVRSKLVNGGGVDVGRYGQNCTHVVVDKLV 57 >ref|XP_002320980.2| BRCT domain-containing family protein, partial [Populus trichocarpa] gi|550324017|gb|EEE99295.2| BRCT domain-containing family protein, partial [Populus trichocarpa] Length = 720 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +1 Query: 559 DDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 D PS F+G+RFVL GFDPV + KV+S L+ GGG+D V Y NCTH IVDKIV Sbjct: 5 DSPSKTFLGVRFVLVGFDPVNKSKVKSKLVGGGGIDAVQYSENCTHVIVDKIV 57 >ref|XP_007051075.1| Transcription coactivators, putative [Theobroma cacao] gi|508703336|gb|EOX95232.1| Transcription coactivators, putative [Theobroma cacao] Length = 1241 Score = 76.6 bits (187), Expect = 8e-12 Identities = 39/63 (61%), Positives = 42/63 (66%) Frame = +1 Query: 529 MLESEQISAYDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVD 708 MLES D PS F+G+RF LFGFDPV E KVR L+ GGGV V Y NCTH IVD Sbjct: 1 MLES------DTPSKTFLGVRFCLFGFDPVNEHKVRVKLINGGGVGVGQYNQNCTHVIVD 54 Query: 709 KIV 717 KIV Sbjct: 55 KIV 57 >ref|XP_002301504.2| BRCT domain-containing family protein [Populus trichocarpa] gi|550345420|gb|EEE80777.2| BRCT domain-containing family protein [Populus trichocarpa] Length = 1221 Score = 76.3 bits (186), Expect = 1e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +1 Query: 559 DDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 D S F+G+RFVLFGFDP+ E +V+S L+ GGGVD V Y NCTH IVDKIV Sbjct: 5 DSHSKTFLGVRFVLFGFDPLSETEVKSKLVNGGGVDAVQYSENCTHVIVDKIV 57 >ref|XP_006492315.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform X2 [Citrus sinensis] Length = 1277 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +1 Query: 559 DDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 D S F+G+RFVLFGFDP+ E +VRS L++GGGVDV Y +CTH IVDKIV Sbjct: 4 DCQSKPFIGVRFVLFGFDPINERQVRSKLIDGGGVDVGLYTQSCTHVIVDKIV 56 >ref|XP_006492314.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform X1 [Citrus sinensis] Length = 1317 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +1 Query: 559 DDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 D S F+G+RFVLFGFDP+ E +VRS L++GGGVDV Y +CTH IVDKIV Sbjct: 4 DCQSKPFIGVRFVLFGFDPINERQVRSKLIDGGGVDVGLYTQSCTHVIVDKIV 56 >ref|XP_006444467.1| hypothetical protein CICLE_v100245902mg, partial [Citrus clementina] gi|557546729|gb|ESR57707.1| hypothetical protein CICLE_v100245902mg, partial [Citrus clementina] Length = 192 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +1 Query: 559 DDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 D S F+G+RFVLFGFDP+ E +VRS L++GGGVDV Y +CTH IVDKIV Sbjct: 4 DCQSKPFIGVRFVLFGFDPINERQVRSKLIDGGGVDVGLYTQSCTHVIVDKIV 56 >gb|EPS63240.1| hypothetical protein M569_11549 [Genlisea aurea] Length = 1055 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/63 (53%), Positives = 44/63 (69%) Frame = +1 Query: 529 MLESEQISAYDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVD 708 M E +I +D S F G+RFVLFGFD + ++VR LL+GGGVD YGP+CTH IVD Sbjct: 1 MSEDREIFMHDRFSRTFRGVRFVLFGFDSAKGDEVRMKLLQGGGVDSKTYGPDCTHVIVD 60 Query: 709 KIV 717 ++V Sbjct: 61 RVV 63 >ref|XP_002515302.1| DNA replication regulator dpb11, putative [Ricinus communis] gi|223545782|gb|EEF47286.1| DNA replication regulator dpb11, putative [Ricinus communis] Length = 1069 Score = 74.3 bits (181), Expect = 4e-11 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +1 Query: 565 PSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 PS F+G+RFVLFGFDP+ +VR+ L++GGGVD Y NCTH IVDKIV Sbjct: 6 PSKTFLGVRFVLFGFDPINLRQVRAKLIDGGGVDAGQYNENCTHVIVDKIV 56 >ref|XP_007199477.1| hypothetical protein PRUPE_ppa027200mg [Prunus persica] gi|462394877|gb|EMJ00676.1| hypothetical protein PRUPE_ppa027200mg [Prunus persica] Length = 1235 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +1 Query: 547 ISAYDDPSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 +S + PS F+G+RF+L GFDP+ E+KVRS L+ G VDV +Y PNC+H +VDK V Sbjct: 1 MSEGNSPSKTFLGVRFILLGFDPLHEQKVRSKLVGCGAVDVGHYSPNCSHVVVDKTV 57 >ref|XP_004301808.1| PREDICTED: uncharacterized protein LOC101306440 [Fragaria vesca subsp. vesca] Length = 1367 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +1 Query: 565 PSNAFVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKI 714 P F+G+RFVL GFDP+ E +VRS L++ GGVDV Y PNCTH IVD+I Sbjct: 7 PPQTFLGVRFVLLGFDPINERQVRSKLVDHGGVDVGIYSPNCTHIIVDRI 56 >gb|EXB59333.1| BRCT domain-containing protein [Morus notabilis] Length = 1286 Score = 67.4 bits (163), Expect = 5e-09 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = +1 Query: 577 FVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDKIV 717 F+G+RFVL GFD E+KVRS L+EGGGVD Y NCTH IVD IV Sbjct: 11 FIGVRFVLSGFDLPNEQKVRSKLVEGGGVDAGQYSKNCTHVIVDNIV 57 >ref|XP_004136156.1| PREDICTED: uncharacterized protein LOC101219784 [Cucumis sativus] Length = 1372 Score = 67.0 bits (162), Expect = 6e-09 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +1 Query: 577 FVGIRFVLFGFDPVREEKVRSALLEGGGVDVVNYGPNCTHAIVDK 711 F+G+ FVLFGF+ V E++VRS L++GGGVDV YGP+C+H IVDK Sbjct: 10 FLGVHFVLFGFNIVDEKQVRSKLIDGGGVDVGQYGPSCSHVIVDK 54 >gb|EPS68251.1| hypothetical protein M569_06518, partial [Genlisea aurea] Length = 621 Score = 66.2 bits (160), Expect = 1e-08 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = +3 Query: 222 DEKKLAEDLIAIVEEVKKIGEFRKTQRKQATNLVRRLKQFLPLLEEIR 365 DEK LA++ IAIVE V+ IGE+R+TQRK+ ++VRR+K FLP+L+EIR Sbjct: 1 DEKNLADEAIAIVESVRSIGEYRRTQRKECQSIVRRMKLFLPILKEIR 48 >gb|EYU36563.1| hypothetical protein MIMGU_mgv1a002804mg [Mimulus guttatus] Length = 636 Score = 64.3 bits (155), Expect = 4e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +3 Query: 222 DEKKLAEDLIAIVEEVKKIGEFRKTQRKQATNLVRRLKQFLPLLEEIR 365 D L E ++A+++ VK IGE+RKTQRK+ NLVRRLK FLP L+EIR Sbjct: 38 DNYNLVESIVAVIQSVKAIGEYRKTQRKECKNLVRRLKLFLPFLDEIR 85