BLASTX nr result
ID: Mentha28_contig00018666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00018666 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR92334.1| putative dienelactone hydrolase family protein [S... 60 3e-07 >gb|ABR92334.1| putative dienelactone hydrolase family protein [Salvia miltiorrhiza] Length = 237 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 3 SILGAENDDLSPPELVKQFEAALNAKPEVDSSTLLFS 113 SILGAE D +SPPELVKQFEAALNAKPEVDS +F+ Sbjct: 164 SILGAETDHISPPELVKQFEAALNAKPEVDSFVKIFA 200