BLASTX nr result
ID: Mentha28_contig00010861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010861 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ91430.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 gb|EPS74310.1| hypothetical protein M569_00444, partial [Genlise... 57 3e-06 ref|NP_001063763.1| Os09g0532700 [Oryza sativa Japonica Group] g... 57 3e-06 ref|XP_002265202.2| PREDICTED: uncharacterized protein LOC100259... 57 3e-06 emb|CBI24546.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EEE70104.1| hypothetical protein OsJ_30114 [Oryza sativa Japo... 57 3e-06 gb|EEC84938.1| hypothetical protein OsI_32153 [Oryza sativa Indi... 57 3e-06 gb|EEC84937.1| hypothetical protein OsI_32152 [Oryza sativa Indi... 57 3e-06 emb|CAN66342.1| hypothetical protein VITISV_024326 [Vitis vinifera] 57 3e-06 gb|EXB89500.1| Cryptochrome DASH [Morus notabilis] 57 3e-06 gb|EYU24980.1| hypothetical protein MIMGU_mgv1a002186mg [Mimulus... 56 4e-06 ref|XP_006421725.1| hypothetical protein CICLE_v10004462mg [Citr... 56 4e-06 ref|XP_007038429.1| Hydrolase, putative isoform 2 [Theobroma cac... 56 4e-06 ref|XP_007038428.1| Hydrolase, putative isoform 1 [Theobroma cac... 56 4e-06 ref|XP_007218944.1| hypothetical protein PRUPE_ppa002337mg [Prun... 56 4e-06 ref|XP_002322411.2| hypothetical protein POPTR_0015s14550g [Popu... 56 6e-06 gb|EMT03944.1| hypothetical protein F775_18465 [Aegilops tauschii] 56 6e-06 ref|XP_003578506.1| PREDICTED: uncharacterized protein LOC100826... 56 6e-06 dbj|BAJ97235.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 dbj|BAJ97114.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 >dbj|BAJ91430.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 429 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGGTSYRTSRKIA 355 E++W+ELLRDFI++VV+EPVHLVGNSIGG + + K+A Sbjct: 369 ELLWSELLRDFIVDVVREPVHLVGNSIGGRTNLVAFKVA 407 >gb|EPS74310.1| hypothetical protein M569_00444, partial [Genlisea aurea] Length = 599 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++WAELLRDFI+EV++EPVHLVGNSIGG Sbjct: 393 ELVWAELLRDFIVEVIQEPVHLVGNSIGG 421 >ref|NP_001063763.1| Os09g0532700 [Oryza sativa Japonica Group] gi|52075945|dbj|BAD46025.1| deoxyribodipyrimidine photolyase family protein-like [Oryza sativa Japonica Group] gi|52077228|dbj|BAD46272.1| deoxyribodipyrimidine photolyase family protein-like [Oryza sativa Japonica Group] gi|113631996|dbj|BAF25677.1| Os09g0532700 [Oryza sativa Japonica Group] Length = 695 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VVKEPVHLVGNSIGG Sbjct: 489 ELLWSELLRDFIVDVVKEPVHLVGNSIGG 517 >ref|XP_002265202.2| PREDICTED: uncharacterized protein LOC100259267 [Vitis vinifera] Length = 722 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E+MWAELLRDFII+VV EPVHLVGNSIGG Sbjct: 511 ELMWAELLRDFIIQVVGEPVHLVGNSIGG 539 >emb|CBI24546.3| unnamed protein product [Vitis vinifera] Length = 704 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E+MWAELLRDFII+VV EPVHLVGNSIGG Sbjct: 493 ELMWAELLRDFIIQVVGEPVHLVGNSIGG 521 >gb|EEE70104.1| hypothetical protein OsJ_30114 [Oryza sativa Japonica Group] Length = 741 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VVKEPVHLVGNSIGG Sbjct: 529 ELLWSELLRDFIVDVVKEPVHLVGNSIGG 557 >gb|EEC84938.1| hypothetical protein OsI_32153 [Oryza sativa Indica Group] Length = 994 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VVKEPVHLVGNSIGG Sbjct: 809 ELLWSELLRDFIVDVVKEPVHLVGNSIGG 837 >gb|EEC84937.1| hypothetical protein OsI_32152 [Oryza sativa Indica Group] Length = 741 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VVKEPVHLVGNSIGG Sbjct: 529 ELLWSELLRDFIVDVVKEPVHLVGNSIGG 557 >emb|CAN66342.1| hypothetical protein VITISV_024326 [Vitis vinifera] Length = 1716 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E+MWAELLRDFII+VV EPVHLVGNSIGG Sbjct: 1558 ELMWAELLRDFIIQVVGEPVHLVGNSIGG 1586 >gb|EXB89500.1| Cryptochrome DASH [Morus notabilis] Length = 856 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E+MWAELLRDFI++VV EPVHLVGNSIGG Sbjct: 486 ELMWAELLRDFIVDVVGEPVHLVGNSIGG 514 >gb|EYU24980.1| hypothetical protein MIMGU_mgv1a002186mg [Mimulus guttatus] Length = 704 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGGTS 379 E++WAEL+RDFIIEVV EPVHLVGNSIGG S Sbjct: 488 ELVWAELVRDFIIEVVGEPVHLVGNSIGGYS 518 >ref|XP_006421725.1| hypothetical protein CICLE_v10004462mg [Citrus clementina] gi|557523598|gb|ESR34965.1| hypothetical protein CICLE_v10004462mg [Citrus clementina] Length = 563 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG---TSYRTSRKIAAFQVG**YIL 325 E+MW+ELLRDF +EVV EPVHL+GNSIGG ++ T K+ AF + Y+L Sbjct: 477 ELMWSELLRDFTVEVVGEPVHLIGNSIGGMFLSTNLTRGKLYAFLLSINYLL 528 >ref|XP_007038429.1| Hydrolase, putative isoform 2 [Theobroma cacao] gi|508775674|gb|EOY22930.1| Hydrolase, putative isoform 2 [Theobroma cacao] Length = 636 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++WAELLRDFIIEVV EPVH+VGNSIGG Sbjct: 475 ELLWAELLRDFIIEVVGEPVHIVGNSIGG 503 >ref|XP_007038428.1| Hydrolase, putative isoform 1 [Theobroma cacao] gi|508775673|gb|EOY22929.1| Hydrolase, putative isoform 1 [Theobroma cacao] Length = 689 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++WAELLRDFIIEVV EPVH+VGNSIGG Sbjct: 475 ELLWAELLRDFIIEVVGEPVHIVGNSIGG 503 >ref|XP_007218944.1| hypothetical protein PRUPE_ppa002337mg [Prunus persica] gi|462415406|gb|EMJ20143.1| hypothetical protein PRUPE_ppa002337mg [Prunus persica] Length = 685 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++WAE+LRDFIIEVV EPVHLVGNSIGG Sbjct: 472 ELLWAEMLRDFIIEVVGEPVHLVGNSIGG 500 >ref|XP_002322411.2| hypothetical protein POPTR_0015s14550g [Populus trichocarpa] gi|550322715|gb|EEF06538.2| hypothetical protein POPTR_0015s14550g [Populus trichocarpa] Length = 690 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E+MWAEL+RDFIIEVV EPVHL+GNSIGG Sbjct: 476 ELMWAELVRDFIIEVVGEPVHLMGNSIGG 504 >gb|EMT03944.1| hypothetical protein F775_18465 [Aegilops tauschii] Length = 603 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VV+EPVHLVGNSIGG Sbjct: 477 ELLWSELLRDFIVDVVREPVHLVGNSIGG 505 >ref|XP_003578506.1| PREDICTED: uncharacterized protein LOC100826912 [Brachypodium distachyon] Length = 706 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VV+EPVHLVGNSIGG Sbjct: 488 ELLWSELLRDFIVDVVREPVHLVGNSIGG 516 >dbj|BAJ97235.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 703 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VV+EPVHLVGNSIGG Sbjct: 485 ELLWSELLRDFIVDVVREPVHLVGNSIGG 513 >dbj|BAJ97114.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 703 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -2 Query: 471 EVMWAELLRDFIIEVVKEPVHLVGNSIGG 385 E++W+ELLRDFI++VV+EPVHLVGNSIGG Sbjct: 485 ELLWSELLRDFIVDVVREPVHLVGNSIGG 513