BLASTX nr result
ID: Mentha28_contig00010781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010781 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial... 58 2e-06 >gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial [Mimulus guttatus] Length = 703 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +3 Query: 78 PSFGAAIYVSRFANNMIENVRRSHEVSNNNKNNKLATLVPQKPVDPDFS 224 PS GAA+Y S+FA NM+ N+RR NN + KL TL+PQKP +PDFS Sbjct: 655 PSIGAAVYASKFATNMLANLRR-----NNIPSPKLPTLLPQKPAEPDFS 698