BLASTX nr result
ID: Mentha28_contig00010658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010658 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014168.1| Uncharacterized protein isoform 1 [Theobroma... 57 2e-06 >ref|XP_007014168.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590580794|ref|XP_007014169.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508784531|gb|EOY31787.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508784532|gb|EOY31788.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 183 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +2 Query: 8 REWMYRRC-SGGSLNPDFIAGVQNFISFAASQTRFMDGDNIRCPCVACDNTRY 163 R WMYRR S G + +F+ GV FI+FA S++ FM + IRCPC C+N ++ Sbjct: 5 RSWMYRRLTSDGFIKDEFVNGVNEFINFARSKSTFMWDNKIRCPCFRCNNNKF 57